LOADING...
   TM0814;TM0814
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0814    TM0814            JCSG 282684 PDB Deposition 02-OCT-15              PDB id: 1o12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0814
DESCRIPTIONN-acetylglucosamine-6-phosphate deacetylase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZS1_THEMA
DR SPTR; Q9WZS1 (flat text); Q9WZS1 (good view)
DR GenBank; AAD35896
DR Pfam; PF01979; Amidohydro_1;
DR Interpro; IPR006680; Amidohydro_1;
DR Interpro; IPR005847; DHOase;
DR Interpro; IPR003764; NagA;
DR PDB; 1O12; Identical; 18-DEC-02; N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;
DR PDB; 2VHL; Highly similar; 04-DEC-07; N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;
DR PDB; 3EGJ; Highly similar; 23-SEP-08; N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;
DR PDB; 3IV8; Highly similar; 08-SEP-09; N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;
DR FFAS; 282684; Fold and function assignment.
DR TVPC; TM0814; Homologs in PDB, JCSG and SG center.
DR OVP; TM0814; Ortholog view popup.
DR TPM; TM0814; Target PDB monitor.
DR FSS; TM0814; Target function coverage.
PROPERTY Residues: 364 aa
Molecule Weight: 40200.31 Dalton
Isoelectric Point: 5.59
Extinction Coefficient: 8940
Gravy Index: -.07
Number of Met residues: 9
Percentage of Met residues: 2.47 %
Number of Cys residues: 5
Percentage of Cys residues: 1.37 %
SEQUENCE  amino acids 364 aa
>TM0814  TM0814 N-acetylglucosamine-6-phosphate deacetylase (nagA)
MIVEKVLIVDPIDGEFTGDVEIEEGKIVKVEKRECIPRGVLMPGFVDPHIHGVVGADTMN
CDFSEMEEFLYSQGVTTFLATTVSTSLEKMKEILRKARDYILENPSTSLLGVHLEGPYIS
KEKKGAHSEKHIRPPSERELSEIDSPAKMLTFAPEIESSELLLRLVKRDIVLSAGHSIAT
FEEFMKFYKEGVKRITHFPNGLKPLHHREIGITGAGLLLDDVKLELICDGVHLSREMVKL
VYKVKKANGIVLVTDSISAAGLKDGTTTLGDLVVKVKDGVPRLEDGTLAGSTLFFSQAVK
NFRKFTGCSITELAKVSSYNSCVELGLDDRGRIAEGTRADLVLLDEDLNVVMTIKEGEVV
FRSR

CDS  cDNA 1092 bp
   1 atgattgttg agaaagttct gatcgttgat cccatcgatg gagagttcac cggggacgtg    60
  61 gagatagaag agggaaagat cgtgaaagtt gagaagagag aatgcattcc acggggtgtt   120
 121 ctcatgcccg ggtttgttga tccgcacatc cacggtgtgg tgggtgcaga caccatgaac   180
 181 tgcgacttct ctgaaatgga agaatttctc tactctcagg gagtcaccac gttccttgcc   240
 241 acaactgttt ccacttcgct cgaaaaaatg aaagaaattc tgagaaaagc aagagattac   300
 301 atccttgaaa acccgtcaac atcgctgctg ggcgttcatc tggagggacc ttacatctcg   360
 361 aaagaaaaaa agggagcaca ctcagagaaa cacataagac caccttcgga gagagaactg   420
 421 agtgaaatcg actctccggc gaagatgctc accttcgcac ctgagataga aagctccgaa   480
 481 cttcttttga gactcgtgaa aagagacatc gttctctctg cgggacactc catcgcaact   540
 541 tttgaggagt tcatgaaatt ctacaaagag ggtgtcaaga gaatcacaca ttttccgaac   600
 601 gggttgaaac ctcttcatca cagggagata ggaatcactg gagcggggct tttgctggac   660
 661 gatgtgaagc tggagctcat ctgcgacggg gtgcatctct ccagagagat ggtgaagctc   720
 721 gtctacaaag tgaaaaaagc gaacggaatc gttctggtca cagattctat atctgcggcg   780
 781 ggtctcaaag acggaacaac caccctggga gatcttgtgg ttaaggtgaa agacggtgtt   840
 841 ccaaggctgg aagacggtac gctcgcggga agcacgctct ttttctcgca ggccgtgaag   900
 901 aacttcagaa agttcacagg gtgttccatt acagaacttg caaaagtgtc ctcgtacaac   960
 961 agctgtgttg aactgggact ggatgacaga ggaagaatag ccgaaggaac gagggcggat  1020
1021 cttgttcttc tcgatgaaga tttgaacgtt gtgatgacga tcaaagaggg tgaggtagtt  1080
1081 tttcgatcca ga  1092
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
837823 838917 1 Glimmer3 score 15.58 good
Genemark probabilities .95   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu