LOADING...
   TM0813;TM0813
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0813    TM0813            JCSG 282683 PDB Deposition 02-JUL-05              PDB id: 1j5x

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0813
DESCRIPTIONGlucosamine-6-phosphate deaminase (EC 3.5.99.6)
ORGANISMThermotoga maritima
COMMENT A homolog of the C-terminal domain of the classic two-domain Glucosamine-6-phosphate synthase/isomerase (such as GlmS of E.coli). Due to the absence of the N-terminal (Gln-amidotransferase) domain, TM0813 is predicted to act only in one direction:
from D-Glucosamine 6-phosphate to D-Fructose 6-phosphate.
Therefore TM0813 is a nonorthologous functional equivalent of the Glucosamine-6-phosphate deaminase encoded by nagB / glmD genes in E.coli.
This supports an unambiguous connection of TM0813 with the peptidoglycan degradation/recylcling pathway (from Chitobiose to D-Fructose 6-phosphate), distinct from the biosynthetic pathway (from Fructose-6P to UDP-N-acetylmuramate ) driven by TM0148 (a full-size homolog of the two-domain GlmS of E.coli).
Genome/Functional context of TM0813 supports this assertion. TM0813 is a part of an extended conserved cluster of genes encoding other enzyme of the degradation pathway: beta-N-acetylhexosaminidase (EC 3.2.1.14, TM0809); N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25, TM0814, another structure solved at JCSG); and predicted N-Acetyl-D-glucosamine Kinase (EC 2.7.1.59, TM0808), which is usually annotated just as N-acetylglucosamine repressor (gene nagC in E.coli).
This cluster also includes genes (TM0810, TM0811, TM0812) likely encoding the ABC-transporter of N-Acetyl-D-glucosamine. Notably, in E.coli the transport of N-Acetyl-D-glucosamine is performed by the alterantive, PTS-like, machinery (gene nagE).
DR UNIPROT; Q9WZS0_THEMA
DR SPTR; Q9WZS0 (flat text); Q9WZS0 (good view)
DR GenBank; AAD35895
DR Pfam; PF01380; SIS;
DR Interpro; IPR001347; SIS;
DR PDB; 1J5X; Identical; 31-JUL-02; GLUCOSAMINE-6-PHOSPHATE DEAMINASE;
DR PDB; 2DEC; Highly similar; 10-AUG-06; 325AA LONG HYPOTHETICAL PROTEIN;
DR PDB; 2DF8; Highly similar; 27-AUG-06; 325AA LONG HYPOTHETICAL PROTEIN;
DR PDB; 2E5F; Highly similar; 26-JUN-07; HYPOTHETICAL PROTEIN PH0510;
DR PDB; 2CB0; Highly similar; 13-MAR-07; GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE;
DR KEGG; 3.5.99.6; Enzyme page
DR FFAS; 282683; Fold and function assignment.
DR TVPC; TM0813; Homologs in PDB, JCSG and SG center.
DR OVP; TM0813; Ortholog view popup.
DR TPM; TM0813; Target PDB monitor.
DR FSS; TM0813; Target function coverage.
PROPERTY Residues: 330 aa
Molecule Weight: 37369.23 Dalton
Isoelectric Point: 5.75
Extinction Coefficient: 21430
Gravy Index: -.12
Number of Met residues: 8
Percentage of Met residues: 2.42 %
Number of Cys residues: 2
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 330 aa
>TM0813  TM0813 conserved hypothetical protein
MSKTLKEITDQKNELKKFFENFVLNLEKTEIFSEIQKNLTDEVLFVGCGSSYNLALTISY
YFERVLKIRTKAIPAGEVAFQKIPDLEERGLAFLFSRTGNTTEVLLANDVLKKRNHRTIG
ITIEEESRLAKESDLPLVFPVREEAIVMTKSFSMILLSLMFLADKIAGNSTERFSELVGY
SPEFFDISWKVIEKIDLKEHDHFVFLGMSEFFGVSLESALKCIEMSLTFSEAYSTLEYRH
GPKALVKKGTLVFMQKVSGMDEQEKRLRKELESLGATVLEVGEGGDIPVSNDWKSAFLRT
VPAQILGYQKAISRGISPDKPPHLEKTVVL

CDS  cDNA 990 bp
   1 atgagcaaaa cactgaaaga gatcacagac cagaaaaacg agttgaagaa gttctttgag    60
  61 aattttgttc tgaatctgga aaaaacggaa atcttcagtg aaatacagaa gaatctgacc   120
 121 gatgaagtgc tctttgtggg atgtgggagt tcgtacaacc tcgctctcac aatctcctat   180
 181 tatttcgaga gagttttgaa gataagaacg aaggcgattc cagcaggtga ggtggctttc   240
 241 caaaagattc cagatctcga ggagagggga ctggcctttc tcttctcgcg aaccggaaac   300
 301 acaacggagg tacttctcgc aaacgatgtt ctgaagaaac gaaaccacag aacgatagga   360
 361 atcaccatag aagaagaatc gagactcgca aaggaaagcg atcttccact tgtgtttccc   420
 421 gtacgagaag aagcgatcgt gatgacgaag tctttcagta tgatcctgct ctctttgatg   480
 481 tttcttgcgg acaagatagc cggaaattca acggagaggt tctcagaact cgttgggtat   540
 541 tcgcccgagt tcttcgatat ctcctggaaa gtgattgaaa agatcgatct gaaagaacac   600
 601 gatcacttcg tgtttcttgg catgtcagag ttttttggag ttagccttga atcggcttta   660
 661 aaatgtatcg agatgtcgct cactttctcg gaggcgtatt caacgcttga atacagacac   720
 721 ggtccaaagg ctctggtgaa aaaaggcacc ctcgttttca tgcaaaaagt gtcgggaatg   780
 781 gatgaacagg agaagcgctt gagaaaagaa ctcgagtcac tcggtgccac cgttctggaa   840
 841 gtaggggaag gtggagatat cccggtgagc aacgattgga aatccgcctt tttgagaact   900
 901 gttcccgctc agattctcgg gtaccagaag gcgatttccc ggggtatctc accagacaag   960
 961 ccacctcatt tggaaaagac cgttgttctg   990
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
836820 837812 3 Glimmer3 score 11.68 poor
Genemark probabilities .86   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu