LOADING...
   TM0800;TM0800
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0800    TM0800            JCSG 282670 PDB Deposition 07-DEC-17              PDB id: 3bo9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0800
DESCRIPTIONputative nitroalkan dioxygenase
ORGANISMThermotoga maritima
COMMENTEnoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)
Product of conserved gene ( FabK of E.coli).
Very important participant of Fatty Acid Biosynthesis(FASII).
Genome and functional context is perfect:clustering on a chromosome with
FabD - Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)(TM0798),
FabZ - (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase (EC 4.2.1.-) (TM0801),
FabF - 3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.41) (TM0802)
DR UNIPROT; Q9WZQ7_THEMA
DR SPTR; Q9WZQ7 (flat text); Q9WZQ7 (good view)
DR GenBank; AAD35882
DR Pfam; PF03060; NMO;
DR Interpro; IPR004136; 2nprop_dioxygen;
DR Interpro; IPR003009; FMN_enzyme;
DR PDB; 3BO9; Identical; 25-DEC-07; PUTATIVE NITROALKAN DIOXYGENASE;
DR PDB; 2Z6I; Highly similar; 01-APR-08; TRANS-2-ENOYL-ACP REDUCTASE II;
DR PDB; 2Z6J; Highly similar; 01-APR-08; TRANS-2-ENOYL-ACP REDUCTASE II;
DR PDB; 4IQL; Highly similar; 29-JAN-14; ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE II;
DR PDB; 2GJL; Highly similar; 16-MAY-06; HYPOTHETICAL PROTEIN PA1024;
DR PDB; 2GJN; Highly similar; 16-MAY-06; HYPOTHETICAL PROTEIN PA1024;
DR PDB; 4Q4K; Highly similar; 16-JUL-14; NITRONATE MONOOXYGENASE;
DR PDB; 3BW4; Highly similar; 13-JAN-09; 2-NITROPROPANE DIOXYGENASE;
DR KEGG; 1.3.1.9; Enzyme page
DR FFAS; 282670; Fold and function assignment.
DR TVPC; TM0800; Homologs in PDB, JCSG and SG center.
DR OVP; TM0800; Ortholog view popup.
DR TPM; TM0800; Target PDB monitor.
DR FSS; TM0800; Target function coverage.
PROPERTY Residues: 314 aa
Molecule Weight: 33671.26 Dalton
Isoelectric Point: 5.63
Extinction Coefficient: 15470
Gravy Index: .06
Number of Met residues: 12
Percentage of Met residues: 3.82 %
Number of Cys residues: 1
Percentage of Cys residues: 0.32 %
SEQUENCE  amino acids 314 aa
>TM0800  TM0800 conserved hypothetical protein
MTVRTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAISEL
RQKTDKPFGVNIILVSPWADDLVKVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVA
SDSLARMVERAGADAVIAEGMESGGHIGEVTTFVLVNKVSRSVNIPVIAAGGIADGRGMA
AAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFAR
KIQEMEFENPMQAEEMLVGSLRRAVVEGDLERGSFMVGQSAGLIDEIKPVKQIIEDILKE
FKETVEKLRGYIEE

CDS  cDNA 942 bp
   1 atgaccgtga gaacaagagt gacagatctt ctggaaatag agcatccaat cctcatgggt    60
  61 ggaatggcct gggcgggaac tcccaccctc gcagcagcgg tatcggaggc gggaggactt   120
 121 ggaatcatcg gatccggagc catgaagccg gacgacctga gaaaagcgat ctccgaactc   180
 181 agacagaaga cggacaaacc cttcggtgta aacataatcc ttgtctctcc gtgggcggac   240
 241 gatctcgtca aggtgtgcat agaagagaaa gtacccgtcg tcacgttcgg tgcgggaaac   300
 301 ccaacgaagt acataaggga actcaaggaa aacggaacaa aggtgatacc cgttgtcgcc   360
 361 tccgactctc tggcaaggat ggtggaaaga gcgggagcgg atgcggtgat agcggaaggg   420
 421 atggagtccg gtggacacat aggtgaagtc acaaccttcg ttctcgtcaa caaagtctcc   480
 481 aggagtgtga acatccccgt gatcgcagcg ggaggcatcg ccgacggaag aggtatggca   540
 541 gccgccttcg cactcggagc ggaagccgtt cagatgggaa ccaggtttgt ggcgagtgtg   600
 601 gaaagcgacg tgcacccggt ttacaaagaa aagatcgtca aggcttccat aagagacacc   660
 661 gttgtgacgg gagccaaact tggacacccc gcgcgcgttc tcagaactcc ctttgcaagg   720
 721 aagatccagg agatggagtt tgaaaacccc atgcaggctg aagaaatgct ggtgggaagt   780
 781 ctcagaagag cggtcgttga aggcgatctg gagagaggat ccttcatggt gggacagagc   840
 841 gccggcttga tcgatgagat aaaaccggtg aagcagatca tagaggatat cctgaaggag   900
 901 ttcaaagaaa cggtggagaa gctgaggggg tacatcgaag ag   942
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
821189 822133 -2 Glimmer3 score 16.52 good
Genemark probabilities .95   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu