LOADING...
   TM0796;TM0796
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0796    TM0796            JCSG 282666 PDB Deposition 06-FEB-13              PDB id: 2g0t

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0796
DESCRIPTIONPutative nucleotide binding protein
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZQ3_THEMA
DR SPTR; Q9WZQ3 (flat text); Q9WZQ3 (good view)
DR GenBank; AAD35878
DR Pfam; PF07755; DUF1611;
DR PDB; 2G0T; Identical; 28-FEB-06; CONSERVED HYPOTHETICAL PROTEIN;
DR PDB; 2OBN; Highly similar; 16-JAN-07; HYPOTHETICAL PROTEIN;
DR FFAS; 282666; Fold and function assignment.
DR TVPC; TM0796; Homologs in PDB, JCSG and SG center.
DR OVP; TM0796; Ortholog view popup.
DR TPM; TM0796; Target PDB monitor.
DR FSS; TM0796; Target function coverage.
PROPERTY Residues: 338 aa
Molecule Weight: 36979.84 Dalton
Isoelectric Point: 5.82
Extinction Coefficient: 35410
Gravy Index: .02
Number of Met residues: 6
Percentage of Met residues: 1.78 %
Number of Cys residues: 2
Percentage of Cys residues: 0.59 %
SEQUENCE  amino acids 338 aa
>TM0796  TM0796 conserved hypothetical protein
MDLWKLYQPGTPAAIVAWGQLGTAHAKTTYGLLRHSRLFKPVCVVAEHEGKMASDFVKPV
RYDVPVVSSVEKAKEMGAEVLIIGVSNPGGYLEEQIATLVKKALSLGMDVISGLHFKISQ
QTEFLKIAHENGTRIIDIRIPPLELDVLRGGIYRKKIKVVGVFGTDCVVGKRTTAVQLWE
RALEKGIKAGFLATGQTGILIGADAGYVIDAVPADFVSGVVEKAVLKLEKTGKEIVFVEG
QGALRHPAYGQVTLGLLYGSNPDVVFLVHDPSRDHFESFPEIPKKPDFEEERRLIETLSN
AKVIGGVSLNGGFETDLPVYDPFNTDDLDEMLERAMVW

CDS  cDNA 1014 bp
   1 atggatctct ggaaattata ccagcccggc acaccagcgg cgatcgtggc gtggggacag    60
  61 ctgggaacag ctcatgccaa aaccacctat ggacttctaa ggcacagcag actcttcaaa   120
 121 cccgtttgtg tagtcgcgga acacgaaggg aagatggcga gtgactttgt gaagcccgtt   180
 181 cgatacgacg tgcccgtggt ctcctctgtt gaaaaggcga aagaaatggg agctgaggtt   240
 241 ctgataattg gagtgtcgaa tcctggtgga tatctggaag agcagatagc gacactcgta   300
 301 aaaaaggcac tctcactcgg tatggatgtc atttctggtc ttcatttcaa aatctcacag   360
 361 caaacagaat ttctgaagat tgcccatgaa aacggtacga gaataataga cattcgcatt   420
 421 ccacctctcg agctcgacgt tctcagggga ggtatatacc gaaagaagat aaaagtcgtc   480
 481 ggtgtattcg gaaccgactg cgtggtaggt aaaagaacca ccgctgttca gctctgggaa   540
 541 agagctctgg agaaggggat caaagcgggt tttctcgcaa caggacagac agggatcctc   600
 601 ataggagcgg atgcggggta cgtgatcgac gctgttcccg cggatttcgt ttccggtgtg   660
 661 gtggaaaaag ctgttctgaa actcgaaaaa acgggaaaag agatcgtctt cgtggaggga   720
 721 caaggagccc tgagacatcc cgcttacggc caggtcaccc tcggccttct gtacggttcc   780
 781 aatcctgacg tggttttcct ggttcacgat ccgagcagag accattttga atctttcccg   840
 841 gaaattccaa aaaaaccgga ttttgaagag gaaagaaggt tgatagagac tctctctaac   900
 901 gcgaaggtga taggtggggt gtctctcaac ggaggcttcg aaacggatct tcccgtttac   960
 961 gatccgttca acacagatga cctcgacgag atgctggaga gggcaatggt atgg  1014
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
818134 819150 1 Glimmer3 score 11.75 poor
Genemark probabilities .92   .33 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu