LOADING...
   TM0771;TM0771
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0771    TM0771            JCSG 360384 PDB Deposition 06-APR-10              PDB id: 2gno

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0771
DESCRIPTIONDNA polymerase III, gamma subunit-related protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZM9_THEMA
DR SPTR; Q9WZM9 (flat text); Q9WZM9 (good view)
DR GenBank; AAD35853
DR PDB; 2GNO; Identical; 18-APR-06; DNA POLYMERASE III, GAMMA SUBUNIT-RELATED PROTEIN CHAIN: A;
DR FFAS; 282641; Fold and function assignment.
DR TVPC; TM0771; Homologs in PDB, JCSG and SG center.
DR OVP; TM0771; Ortholog view popup.
DR TPM; TM0771; Target PDB monitor.
DR FSS; TM0771; Target function coverage.
PROPERTY Residues: 312 aa
Molecule Weight: 36270.1 Dalton
Isoelectric Point: 6
Extinction Coefficient: 36900
Gravy Index: -.29
Number of Met residues: 4
Percentage of Met residues: 1.28 %
Number of Cys residues: 2
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 312 aa
>TM0771  TM0771 DNA polymerase III, gamma subunit-related protein
MNDLIRKYAKDQLETLKRIIEKSEGISILINGEDLSYPREVSLELPEYVEKFPPKASDVL
EIDPEGENIGIDDIRTIKDFLNYSPELYTRKYVIVHDCERMTQQAANAFLKALEEPPEYA
VIVLNTRRWHYLLPTIKSRVFRVVVNVPKEFRDLVKEKIGDLWEELPLLERDFKTALEAY
KLGAEKLSGLMESLKVLETEKLLKKVLSKGLEGYLACRELLERFSKVESKEFFALFDQVT
NTITGKDAFLLIQRLTRIILHENTWESVEDQKSVSFLDSILRVKIANLNNKLTLMNILAI
HRERKRGVNAWS

CDS  cDNA 936 bp
   1 atgaacgatt tgatcagaaa gtacgctaaa gatcaactgg aaactttgaa aaggatcata    60
  61 gaaaagtctg aaggaatatc catcctcata aatggagaag atctctcgta tccgagagaa   120
 121 gtatcccttg aacttcccga gtacgtggag aaatttcccc cgaaggcctc ggatgttctg   180
 181 gagatagatc ccgaggggga gaacataggc atagacgaca tcagaacgat aaaggacttc   240
 241 ctgaactaca gccccgagct ctacacgaga aagtacgtga tagtccacga ctgtgaaaga   300
 301 atgacccagc aggcggcgaa cgcgtttctg aaggcccttg aagaaccacc agaatacgct   360
 361 gtgatcgttc tgaacactcg ccgctggcat tatctactgc cgacgataaa gagccgagtg   420
 421 ttcagagtgg ttgtgaacgt tccaaaggag ttcagagatc tcgtgaaaga gaaaatagga   480
 481 gatctctggg aggaacttcc acttcttgag agagacttca aaacggctct cgaagcctac   540
 541 aaacttggtg cggaaaaact ttctggattg atggaaagtc tcaaagtttt ggagacggaa   600
 601 aaactcttga aaaaggtcct ttcaaaaggc ctcgaaggtt atctcgcatg tagggagctc   660
 661 ctggagagat tttcaaaggt ggaatcgaag gaattctttg cgctttttga tcaggtgact   720
 721 aacacgataa caggaaaaga cgcgtttctt ttgatccaga gactgacaag aatcattctc   780
 781 cacgaaaaca catgggaaag cgttgaagat caaaaaagcg tgtctttcct cgattcaatt   840
 841 ctcagggtga agatagcgaa tctgaacaac aaactcactc tgatgaacat cctcgcgata   900
 901 cacagagaga gaaagagagg tgtcaacgct tggagc   936
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
798662 799600 2 Glimmer3 score 15.76 good
Genemark probabilities .95   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu