LOADING...
   TM0755;TM0755
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0755    TM0755            JCSG 282625 PDB Deposition 04-SEP-21              PDB id: 1vme

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0755
DESCRIPTIONFlavoprotein
ORGANISMThermotoga maritima
COMMENTBelongs to very conservative Flavoprotein family.
Multiple external annotations of very close homologs (Petrotoga miotherma, Pyrococcus abyssi , Archaeoglobus fulgidus ) from various sources consistently point to Flavodoxin or Flavoprotein function.
Escherichia coli homolog annotated in KEGG, PIR NREF Database, Genbank:
Anaerobic nitric oxide reductase flavorubredoxin (FlRd) (FlavoRb).

Genome and functional context supportive:
clustering on a chromosome with TM0754 - NADH oxidase /nitrite reductase ( Clostridium acetobutylicum, Escherichia coli K12, Methanobacterium thermoautotrophicum, Salmonella Dublin, Porphyromonas gingivalis W83).
by Psi-Blast: the best score with
COG0426, FpaA, Uncharacterized flavoproteins [Energy production and conversion]
DR UNIPROT; Q9WZL4_THEMA
DR SPTR; Q9WZL4 (flat text); Q9WZL4 (good view)
DR GenBank; AAD35837
DR Pfam; PF00258; Flavodoxin_1;
DR Pfam; PF00753; Lactamase_B;
DR Interpro; IPR001279; Blactmase-like;
DR Interpro; IPR008254; Flav_nitox_synth;
DR PDB; 1VME; Identical; 28-SEP-04; FLAVOPROTEIN;
DR PDB; 4DIK; Identical; 17-OCT-12; FLAVOPROTEIN;
DR PDB; 4DIL; Identical; 17-OCT-12; FLAVOPROTEIN;
DR PDB; 2OHH; Highly similar; 22-MAY-07; TYPE A FLAVOPROTEIN FPRA;
DR PDB; 2OHI; Highly similar; 22-MAY-07; TYPE A FLAVOPROTEIN FPRA;
DR PDB; 2OHJ; Highly similar; 22-MAY-07; TYPE A FLAVOPROTEIN FPRA;
DR FFAS; 282625; Fold and function assignment.
DR TVPC; TM0755; Homologs in PDB, JCSG and SG center.
DR OVP; TM0755; Ortholog view popup.
DR TPM; TM0755; Target PDB monitor.
DR FSS; TM0755; Target function coverage.
PROPERTY Residues: 398 aa
Molecule Weight: 45268.84 Dalton
Isoelectric Point: 5.52
Extinction Coefficient: 65320
Gravy Index: -.2
Number of Met residues: 7
Percentage of Met residues: 1.76 %
Number of Cys residues: 1
Percentage of Cys residues: 0.25 %
SEQUENCE  amino acids 398 aa
>TM0755  TM0755 conserved hypothetical protein
MPKIWTERIFDDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGN
YAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNFGKRLLEGF
YGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYLDGILFSCDVGGGYLLPEILD
DSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKDPQRLL
NHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEKGFTPVVYKFSDEERPAISE
ILKDIPDSEALIFGVSTYEAEIHPLMRFTLLEIIDKANYEKPVLVFGVHGWAPSAERTAG
ELLKETKFRILSFTEIKGSNMDERKIEEAISLLKKELE

CDS  cDNA 1194 bp
   1 atgccaaaaa tctggactga aaggatcttc gacgatccgg aaatctacgt tttgaggata    60
  61 gatgatgacc gaataagata cttcgaagcg gtctgggaaa tacccgaagg gatcagctac   120
 121 aacgcatatc ttgtgaagct gaatggtgca aacgttctga tagacggctg gaagggaaac   180
 181 tacgcaaaag agttcatcga cgctctgtcc aagatcgttg atcccaaaga gatcacgcac   240
 241 atcatcgtaa accacaccga gccggaccac agcggatctc tccccgcaac actcaaaacg   300
 301 attggacacg atgtggaaat aatcgcttcg aacttcggaa aaagacttct cgaaggcttc   360
 361 tacggcataa aagacgtgac tgtcgtgaag gatggagaag agagagaaat cggaggaaaa   420
 421 aaattcaaat tcgtcatgac tccatggctt cactggcccg acacgatggt gacgtatctt   480
 481 gatggaattc tcttcagctg tgatgtgggt ggtggatacc tgctcccaga gatcctggac   540
 541 gactcaaacg agagcgttgt ggaaaggtac cttccccacg tcacaaagta catcgtcacg   600
 601 gtgataggcc attacaagaa ttacatcctc gaaggtgcgg aaaagctctc cagtctgaag   660
 661 ataaaggcgc tccttccagg gcacggactg atctggaaga aagatcctca gagacttttg   720
 721 aatcactacg tgagcgttgc aaagggagat ccgaaaaaag gaaaggtcac ggtgatctac   780
 781 gattccatgt acggcttcgt cgagaacgtg atgaagaagg cgatcgactc tctcaaggag   840
 841 aaaggtttca caccggttgt gtacaaattc tccgacgaag agagacccgc gatcagcgag   900
 901 atcctgaaag acatcccgga cagtgaagca ctgatcttcg gtgtttccac ctacgaagca   960
 961 gagatacatc cactcatgag attcaccctt ctcgagataa tagataaagc gaactacgaa  1020
1021 aaacccgtcc tcgtctttgg agtgcacggc tgggctccat ccgcagaaag aacagcagga  1080
1081 gagcttctga aagaaacgaa gttcagaatt ctctccttca cggagataaa aggttcaaac  1140
1141 atggatgaga gaaagatcga agaggcgata tctcttctca aaaaagaact ggag  1194
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
777704 778900 -2 Glimmer3 score 16.94 good
Genemark probabilities .94   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu