LOADING...
   TM0752;TM0752
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0752    TM0752            JCSG 282622 PDB Deposition 04-MAR-22              PDB id: 1vjt

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0752
DESCRIPTIONalpha-glucuronidase (EC 3.2.1.139).
ORGANISMThermotoga maritima
COMMENTAccording to the classification of carbohydrate-active enzymes ( CAZY ) TM0752 belongs to the Glycoside Hydrolase Family 4. Among members of this large family of closely related paralogs are several other enzymes with similar glycohydrolase activities. At least four additional close paralogs are present in T.maritima genome with tentative assignments:
TM0434: another alpha-glucuronidase (EC 3.2.1.139);
TM1834: alpha-glucosidase (EC 3.2.1.20 );
TM1068: alpha-galactosidase (EC 3.2.1.22);
TM1281: 6-P-beta-glucosidase.
Genome context: no helpful conserved operons could be revealed for TM0752.
Functional context: All of the glycohydrolase activities cited above (including alpha-glucuronidase) are involved in carbohydrate utilization, which plays an important role in organotrophic lifestyle of T.maritima.
An experimental paper completly confirming the alpha-glucuronidase function of TM0752( see Reference ).
DR UNIPROT; Q9WZL1_THEMA
DR SPTR; Q9WZL1 (flat text); Q9WZL1 (good view)
DR GenBank; AAD35834
DR Pfam; PF02056; Glyco_hydro_4;
DR Interpro; IPR001088; Glyco_hydro_4;
DR PDB; 1VJT; Identical; 30-MAR-04; ALPHA-GLUCOSIDASE;
DR PDB; 3U95; Identical; 26-SEP-12; GLYCOSIDE HYDROLASE, FAMILY 4;
DR PDB; 1OBB; Highly similar; 21-MAY-03; ALPHA-GLUCOSIDASE;
DR KEGG; 3.2.1.139; Enzyme page
DR FFAS; 282622; Fold and function assignment.
DR TVPC; TM0752; Homologs in PDB, JCSG and SG center.
DR OVP; TM0752; Ortholog view popup.
DR TPM; TM0752; Target PDB monitor.
DR FSS; TM0752; Target function coverage.
PROPERTY Residues: 471 aa
Molecule Weight: 55354.6 Dalton
Isoelectric Point: 5.85
Extinction Coefficient: 101760
Gravy Index: -.55
Number of Met residues: 15
Percentage of Met residues: 3.18 %
Number of Cys residues: 3
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 471 aa
>TM0752  TM0752 alpha-glucosidase, putative
MKISIIGAGSVRFALQLVGDIAQTEELSREDTHIYMMDVHERRLNASYILARKYVEELNS
PVKIVKTSSLDEAIDGADFIINTAYPYDPRYHDSGSQRWDEVTKVGEKHGYYRGIDSQEL
NMVSTYTYVLSSYPDMKLALEIAEKMKKMAPKAYLMQTANPVFEITQAVRRWTGANIVGF
CHGVAGVYEVFEKLDLDPEEVDWQVAGVNHGIWLNRFRYRGEDAYPLLDEWIEKKLPEWE
PKNPWDTQMSPAAMDMYKFYGMLPIGDTVRNGSWKYHYNLETKKKWFGKFGGIDNEVERP
KFHEQLRRARERLIKLAEEVQQNPGMKLTEEHPEIFPKGKLSGEQHIPFINAIANNKRVR
LFLNVENQGTLKDFPDDVVMELPVWVDCCGIHREKVEPDLTHRIKIFYLWPRILRMEWNL
EAYISRDRKVLEEILIRDPRTKSYEQIVQVLDEIFNLPFNEELRRYYKEKL

CDS  cDNA 1413 bp
   1 atgaagatct ccatcatcgg agcaggaagt gtgaggttcg cacttcagct tgtgggagac    60
  61 atcgctcaga cggaggaact ttcaagggaa gatacacaca tctacatgat ggacgttcac   120
 121 gaaagaagac tgaacgcatc ttacatcctc gcaagaaagt acgtggaaga gctgaactct   180
 181 cctgtgaaga tcgtaaaaac atccagtctg gatgaagcca tagatggagc agacttcatc   240
 241 ataaacaccg cctatcctta cgatccgagg taccacgaca gcggctctca aagatgggac   300
 301 gaggtcacaa aggtcggtga aaaacacggc tactacagag gaatagacag tcaagagctg   360
 361 aacatggttt ccacttacac ctacgttctt tcttcttatc ccgacatgaa gctcgccctc   420
 421 gagatagcgg agaagatgaa aaagatggca cccaaagcgt acttgatgca gacggcaaat   480
 481 cccgtcttcg agatcacgca ggcggtgaga aggtggactg gtgcgaacat agtggggttc   540
 541 tgccacggtg ttgccggggt ttatgaagtc ttcgaaaaac tcgacctcga tccggaagag   600
 601 gtagactggc aggtcgccgg ggtgaaccac ggtatctggc tgaacaggtt cagatacaga   660
 661 ggagaagatg catacccgct tcttgacgag tggatagaga agaagctacc agagtgggag   720
 721 ccgaagaacc catgggacac acagatgtct cctgccgcga tggatatgta caaattttac   780
 781 ggtatgcttc cgataggtga caccgtgagg aacggcagct ggaagtacca ctacaacctg   840
 841 gagacgaaga agaagtggtt tggaaagttc ggcggtatag acaacgaagt ggaaagaccg   900
 901 aaattccacg agcaactcag aagagcaaga gagcgcctca taaaactcgc agaagaggtt   960
 961 cagcaaaacc caggtatgaa actcacagag gaacatcccg agatcttccc gaaaggaaaa  1020
1021 ctcagcggag aacagcacat tcctttcatc aacgcgatag cgaacaacaa acgtgtgagg  1080
1081 ctctttctga acgtggagaa ccagggaaca ctcaaagact ttcccgatga tgtcgtgatg  1140
1141 gaacttcccg tctgggtgga ctgctgtgga atccacagag agaaagtgga acccgatctc  1200
1201 acccaccgga taaagatctt ctatctgtgg cccaggattc tgagaatgga gtggaactta  1260
1261 gaagcataca tctcgaggga cagaaaggtg ctcgaagaaa tcctcatcag agatccaagg  1320
1321 acaaaatcct acgagcagat cgtgcaagtg ctcgatgaga tcttcaacct gccgttcaac  1380
1381 gaagagttga ggagatacta caaagagaaa ctc  1413
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
774457 775872 -1 Glimmer3 score 15.26 good
Genemark probabilities .97   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu