LOADING...
   TM0741;TM0741
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0741    TM0741            JCSG 359843 PDB Deposition 04-JUL-23              PDB id: 1vlh

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0741
DESCRIPTIONPhosphopantetheine adenylyltransferase (EC 2.7.7.3) (Pantetheine- phosphate adenylyltransferase) (PPAT) (Dephospho-CoA pyrophosphorylase).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: REVERSIBLY TRANSFERS AN ADENYLYL GROUP FROM ATP TO 4'-
PHOSPHOPANTETHEINE, YIELDING DEPHOSPHO-COA (DPCOA) AND
PYROPHOSPHATE (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: ATP + PANTETHEINE 4'-PHOSPHATE = DIPHOSPHATE +
3'-DEPHOSPHO-COA.
-!- PATHWAY: COENZYME A (COA) BIOSYNTHESIS; FOURTH STEP.
-!- SUBUNIT: HOMOHEXAMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE BACTERIAL COAD FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; COAD_THEMA
DR SPTR; Q9WZK0 (flat text); Q9WZK0 (good view)
DR GenBank; AAD35822
DR Pfam; PF01467; CTP_transf_2;
DR Interpro; IPR004821; Cyt_tran_rel;
DR Interpro; IPR004820; Cytidylyltransf;
DR Interpro; IPR001980; LPS_biosynth;
DR PDB; 1VLH; Identical; 17-AUG-04; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR PDB; 1OD6; Highly similar; 13-MAR-03; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR PDB; 3F3M; Highly similar; 20-OCT-09; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR PDB; 1O6B; Highly similar; 25-NOV-03; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR PDB; 4NAH; Highly similar; 12-MAR-14; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR PDB; 4NAT; Highly similar; 12-MAR-14; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR PDB; 4NAU; Highly similar; 12-MAR-14; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR PDB; 3L92; Highly similar; 19-JAN-10; PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;
DR KEGG; 2.7.7.3; Enzyme page
DR FFAS; 282611; Fold and function assignment.
DR TVPC; TM0741; Homologs in PDB, JCSG and SG center.
DR OVP; TM0741; Ortholog view popup.
DR TPM; TM0741; Target PDB monitor.
DR FSS; TM0741; Target function coverage.
PROPERTY Residues: 161 aa
Molecule Weight: 18248.39 Dalton
Isoelectric Point: 6.44
Extinction Coefficient: 14440
Gravy Index: -.03
Number of Met residues: 3
Percentage of Met residues: 1.86 %
Number of Cys residues: 1
Percentage of Cys residues: 0.62 %
SEQUENCE  amino acids 161 aa
>TM0741  TM0741 lipopolysaccharide core biosynthesis protein KdtB (kdtB)
MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMFTLEERKKLIEEVLSDL
DGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASE
KFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKEGKR

CDS  cDNA 483 bp
   1 gtgaaagcgg tctatccagg atcttttgat cccatcactc tcggacatgt ggacatcatc    60
  61 aaaagagcgc tttctatttt cgacgagctt gtggtcctcg tcacggagaa tccgagaaaa   120
 121 aagtgtatgt tcaccttgga ggaaaggaaa aagctgatag aagaggttct cagcgaccta   180
 181 gatggagtga aggtggatgt tcatcatggc ttactcgtgg attatttgaa aaaacatggt   240
 241 ataaaagtct tggtgagagg actcagggct gtgaccgact acgagtacga gctgcagatg   300
 301 gcgcttgcaa acaaaaaatt gtacagcgat ctggaaacag tgtttctgat cgcaagcgaa   360
 361 aaattttctt tcatatcctc cagtcttgtg aaggaagtgg ccctgtacgg cggtgatgtg   420
 421 accgaatggg taccacccga ggtagccaga gccctgaacg aaaagttgaa ggagggaaag   480
 481 cga   483
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
765524 766009 -2 Glimmer3 score 11.2 poor
Genemark probabilities .85   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu