LOADING...
   TM0727;TM0727
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0727    TM0727            JCSG 282597 PDB Deposition 04-JUL-09              PDB id: 1vl4

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0727
DESCRIPTIONPutative modulator of DNA gyrases [Putative modulator of DNA gyrase, PmbA/TldD]
ORGANISMThermotoga maritima
COMMENT Genome and functional context:
highly conserved cluster PmbA-TldD (TM0727-TM0726)
By Psi-Blast:
TldD - Predicted Zn-dependent proteases and their inactivated homologs;
PmbA_TldD - Putative modulator of DNA gyrase. tldD and pmbA were found to suppress mutations in letD and inhibitor of DNA gyrase. Therefore it has been hypothesised that the TldD and PmbA proteins modulate the activity of DNA gyrase. It has also been suggested that PmbA may be involved in secretion.
There are Homologues in eubacteria and archaebacteria, suggesting a broader physiological role.
See Reference for in vivo evidence supporting the hypothesis that TldD and TldE have proteolytic activity.
DR UNIPROT; Q9WZI6_THEMA
DR SPTR; Q9WZI6 (flat text); Q9WZI6 (good view)
DR GenBank; AAD35809
DR Pfam; PF01523; PmbA_TldD;
DR Interpro; IPR002510; Peptidase_U62;
DR PDB; 1VL4; Identical; 21-SEP-04; PMBA-RELATED PROTEIN;
DR PDB; 3QTD; Highly similar; 30-MAR-11; PMBA PROTEIN;
DR FFAS; 282597; Fold and function assignment.
DR TVPC; TM0727; Homologs in PDB, JCSG and SG center.
DR OVP; TM0727; Ortholog view popup.
DR TPM; TM0727; Target PDB monitor.
DR FSS; TM0727; Target function coverage.
PROPERTY Residues: 435 aa
Molecule Weight: 48303.93 Dalton
Isoelectric Point: 5.13
Extinction Coefficient: 24410
Gravy Index: -.28
Number of Met residues: 17
Percentage of Met residues: 3.91 %
Number of Cys residues: 1
Percentage of Cys residues: 0.23 %
SEQUENCE  amino acids 435 aa
>TM0727  TM0727 pmbA-related protein
MTFEEFKDRLFALAKKNGVEVQISFLETREFSLRLANGDLDQYTDAGKFNVEIKVLKDGK
TGTFRTQVLENPEKCFEEALSNLQVKDSEEKEYFFEGGKEYREMETYVGRFEKLSVKEKM
DMAKKAHESAAKDERVVMVPTVMYKDMVIKKIITNTLGLDVESQMDGGFLFAMAIARDAN
PRSGSWYELARTPEDLNPEEIGKRAAEEAISLIGSKTIPSGKYPVLMRNTALLDLMEMFI
PMISAENVQKNLSPLKGKLGEQVGNPAVSIKDLPYHPKGLSSTPFDDEGVPTTEKFVLEN
GVLKTFLHNLKTARKEGVEPTGNGFVGGIRPVNLMLMPGEKSFEELLKEMDRGVVITEVE
GMHAGANSISGEFSLFAKGYWVENGEIAHGVEDITISGNFLDLLRKIVLVGNDVKVSQHT
IAPSVLVEVLDVAGK

CDS  cDNA 1305 bp
   1 atgactttcg aagaattcaa agatagattg ttcgctcttg caaagaaaaa tggagtggaa    60
  61 gttcagataa gttttctgga aaccagagaa ttttctcttc gcctcgcaaa cggtgacctc   120
 121 gatcagtaca cggacgcagg aaagttcaac gtggagataa aggtactgaa ggatggaaaa   180
 181 acaggaacgt tcagaacaca ggttctggaa aatccagaaa agtgtttcga agaggcactg   240
 241 agcaatttgc aggtcaaaga cagcgaagag aaagaatact tcttcgaggg tgggaaagag   300
 301 tacagagaaa tggaaacgta cgttgggaga ttcgaaaagc tctccgtcaa agagaaaatg   360
 361 gatatggcca aaaaggctca cgagagcgct gcgaaagacg aacgcgttgt catggtacca   420
 421 acggtcatgt acaaggacat ggtaataaag aagatcatca ccaacacact gggtttggac   480
 481 gttgagagtc agatggatgg cggtttcctt ttcgccatgg caatcgcgag agatgccaat   540
 541 ccgcgatctg gttcctggta tgaactggcg cggacaccgg aagatctgaa tcccgaggaa   600
 601 atagggaaaa gagccgcaga ggaggcaatt tctctcatcg gctcaaaaac aataccctcc   660
 661 gggaagtatc ctgtgttgat gagaaataca gcgctgcttg atctcatgga gatgttcata   720
 721 cccatgatat cggctgaaaa cgtgcagaaa aatctttctc cactgaaggg aaagcttgga   780
 781 gagcaggtgg gaaatcctgc tgtttcgata aaggatctgc cttaccatcc caagggactt   840
 841 tccagcactc ccttcgacga tgaaggagtg ccaacaaccg agaaatttgt gctggagaac   900
 901 ggtgtgctga aaacgttcct tcacaacctg aaaacggcca gaaaagaagg agtagaacca   960
 961 acgggaaatg gattcgtagg aggaatacgt ccggtcaatc tcatgctgat gccgggtgag  1020
1021 aaatcttttg aagaactttt gaaggagatg gacagagggg tcgttatcac ggaagttgag  1080
1081 gggatgcacg cgggagcgaa ttctatatct ggggaatttt cactgtttgc gaagggatac  1140
1141 tgggtggaga acggagagat cgcgcatggt gtggaagaca tcaccatatc gggtaacttc  1200
1201 ctcgatcttc tgagaaagat agttctcgtt ggaaacgatg tgaaggtgtc tcaacacacg  1260
1261 atagcaccaa gtgttctggt ggaggttctg gatgtggcgg gaaaa  1305
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
750758 752065 2 Glimmer3 score 12.17 good
Genemark probabilities .92   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu