LOADING...
   TM0723;TM0723
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0723    TM0723            JCSG 282593 PDB Deposition 04-SEP-30              PDB id: 1vmj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0723
DESCRIPTIONPutative thiamin phosphate synthase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZI2_THEMA
DR SPTR; Q9WZI2 (flat text); Q9WZI2 (good view)
DR GenBank; AAD35805
DR Pfam; PF01894; UPF0047;
DR Interpro; IPR001602; UPF0047;
DR PDB; 1VMJ; Identical; 12-OCT-04; HYPOTHETICAL PROTEIN TM0723;
DR PDB; 2P6C; Highly similar; 18-SEP-07; AQ_2013 PROTEIN;
DR PDB; 1VE0; Highly similar; 22-MAR-05; HYPOTHETICAL PROTEIN (ST2072);
DR PDB; 1VMH; Highly similar; 05-OCT-04; UNCHARACTERIZED CONSERVED PROTEIN YJBQ/UPF0047 FA ORTHOLOG Y;
DR PDB; 1XBF; Highly similar; 14-SEP-04; CLOSTRIDIUM ACETOBUTYLICUM Q97KL0;
DR PDB; 1VPH; Highly similar; 16-NOV-04; HYPOTHETICAL PROTEIN SSO2532;
DR PDB; 2P6H; Highly similar; 18-SEP-07; HYPOTHETICAL PROTEIN;
DR PDB; 1VMF; Highly similar; 05-OCT-04; HYPOTHETICAL PROTEIN;
DR KEGG; 2.5.1.3; Enzyme page
DR FFAS; 282593; Fold and function assignment.
DR TVPC; TM0723; Homologs in PDB, JCSG and SG center.
DR OVP; TM0723; Ortholog view popup.
DR TPM; TM0723; Target PDB monitor.
DR FSS; TM0723; Target function coverage.
PROPERTY Residues: 139 aa
Molecule Weight: 16327.95 Dalton
Isoelectric Point: 6.08
Extinction Coefficient: 22460
Gravy Index: -.58
Number of Met residues: 5
Percentage of Met residues: 3.60 %
Number of Cys residues: 2
Percentage of Cys residues: 1.44 %
SEQUENCE  amino acids 139 aa
>TM0723  TM0723 conserved hypothetical protein
MKSYRKELWFHTKRRREFINITPLLEECVRESGIKEGLLLCNAMHITASVFINDDEPGLH
HDFEVWLEKLAPEKPYSQYKHNDTGEDNADAHLKRTIMGREVVIAITDRKMDLGPWEQVF
YGEFDGMRPKRVLVKIIGE

CDS  cDNA 417 bp
   1 atgaagagct acagaaaaga actctggttt cacacgaaga ggagaaggga gttcatcaac    60
  61 ataactcccc ttttggagga gtgtgttaga gaaagcggta taaaagaagg gcttcttctc   120
 121 tgcaacgcca tgcacataac cgcgagtgtc ttcataaacg acgatgagcc gggacttcac   180
 181 cacgatttcg aggtgtggct cgaaaaactc gctccggaaa agccgtactc ccagtacaaa   240
 241 cacaacgaca ccggggaaga caacgcggac gctcatctca agcgcacgat catgggaaga   300
 301 gaagtggtca tagccatcac cgatagaaag atggatctgg gaccgtggga acaggttttc   360
 361 tacggtgagt tcgacggtat gaggccaaag agagtcctcg tcaagatcat aggagag   417
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
747053 747472 2 Glimmer3 score 13.03 good
Genemark probabilities .86   .82 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu