LOADING...
   TM0721;TM0721
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0721    TM0721            JCSG 282591 PDB Deposition 03-OCT-03              PDB id: 1o5o

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0721
DESCRIPTIONUracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: UMP + DIPHOSPHATE = URACIL + 5-PHOSPHO-
ALPHA-D-RIBOSE 1-DIPHOSPHATE.
-!- COFACTOR: MAGNESIUM (BY SIMILARITY).
-!- PATHWAY: PYRIMIDINE SALVAGE PATHWAY.
-!- SIMILARITY: BELONGS TO THE UPRTASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; UPP_THEMA
DR SPTR; Q9WZI0 (flat text); Q9WZI0 (good view)
DR GenBank; AAD35803
DR Pfam; PF00156; Pribosyltran;
DR Interpro; IPR000836; PRtransferase;
DR Interpro; IPR005765; Ura_phspho_trans;
DR PDB; 1O5O; Identical; 14-OCT-03; URACIL PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 1I5E; Highly similar; 05-JUN-02; URACIL PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 1V9S; Highly similar; 29-MAR-05; URACIL PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 3DMP; Highly similar; 15-JUL-08; URACIL PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 2EHJ; Highly similar; 11-MAR-08; URACIL PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 2E55; Highly similar; 01-JAN-08; URACIL PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 1XTT; Highly similar; 08-FEB-05; PROBABLE URACIL PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 1XTU; Highly similar; 08-FEB-05; PROBABLE URACIL PHOSPHORIBOSYLTRANSFERASE;
DR KEGG; 2.4.2.9; Enzyme page
DR FFAS; 282591; Fold and function assignment.
DR TVPC; TM0721; Homologs in PDB, JCSG and SG center.
DR OVP; TM0721; Ortholog view popup.
DR TPM; TM0721; Target PDB monitor.
DR FSS; TM0721; Target function coverage.
PROPERTY Residues: 209 aa
Molecule Weight: 23318.98 Dalton
Isoelectric Point: 5.62
Extinction Coefficient: 11920
Gravy Index: -.03
Number of Met residues: 4
Percentage of Met residues: 1.91 %
Number of Cys residues: 1
Percentage of Cys residues: 0.48 %
SEQUENCE  amino acids 209 aa
>TM0721  TM0721 uracil phosphoribosyltransferase (upp)
MKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRHLKCEEVEVETPIT
KTIGYRINDKDIVVVPILRAGLVMADGILELLPNASVGHIGIYRDPETLQAVEYYAKLPP
LNDDKEVFLLDPMLATGVSSIKAIEILKENGAKKITLVALIAAPEGVEAVEKKYEDVKIY
VAALDERLNDHGYIIPGLGDAGDRLFRTK

CDS  cDNA 627 bp
   1 atgaagaatc tcgttgtggt ggatcatccc ctcataaagc acaaactcac gatcatgaga    60
  61 gacaagaaca ccggtccgaa ggagttcaga gagctgctca gagagataac actcctcctc   120
 121 gcgtacgaag ccacgagaca tttgaagtgc gaggaagtag aggtggaaac tcccataacg   180
 181 aaaacgatcg gataccgtat aaacgataag gatatcgtgg tggttcctat tctcagagcc   240
 241 ggtcttgtga tggcggatgg tattcttgaa ctgcttccaa acgcatcggt gggccacata   300
 301 ggaatataca gagatccgga gacacttcaa gcggtggaat actacgccaa gctgcctcct   360
 361 ctcaacgacg acaaagaggt ctttttgctg gatcccatgc tggcgacggg tgtttcttcg   420
 421 ataaaggcca tcgagatttt gaaggagaac ggggcgaaga agatcacgct ggtggctctg   480
 481 atcgcggctc cagagggagt ggaagcggtg gagaaaaaat acgaagatgt taaaatctac   540
 541 gttgcagcac tggacgagcg cctcaacgat cacggttaca tcattcctgg tcttggagat   600
 601 gcgggtgaca gactcttcag gacaaaa   627
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
744280 744909 1 Glimmer3 score 13.29 good
Genemark probabilities .93   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu