LOADING...
   TM0720;TM0720
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0720    TM0720            JCSG 282590 MR Tracing 03-OCT-08

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0720
DESCRIPTIONSerine hydroxymethyltransferase (EC 2.1.2.1) (Serine methylase) (SHMT).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: INTERCONVERSION OF SERINE AND GLYCINE.
-!- CATALYTIC ACTIVITY: 5,10-METHYLENETETRAHYDROFOLATE + GLYCINE +
H(2)O = TETRAHYDROFOLATE + L-SERINE.
-!- COFACTOR: PYRIDOXAL PHOSPHATE (BY SIMILARITY).
-!- PATHWAY: KEY ENZYME IN THE BIOSYNTHESIS OF PURINES, LIPIDS,
HORMONES AND OTHER COMPONENTS.
-!- SUBUNIT: HOMOTETRAMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE SHMT FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; GLYA_THEMA
DR SPTR; Q9WZH9 (flat text); Q9WZH9 (good view)
DR GenBank; AAD35802
DR Pfam; PF00464; SHMT;
DR Interpro; IPR001085; Gly_Hymtfrase;
DR PDB; 2DKJ; Highly similar; 24-APR-07; SERINE HYDROXYMETHYLTRANSFERASE;
DR PDB; 1KKJ; Highly similar; 10-JUL-02; SERINE HYDROXYMETHYLTRANSFERASE;
DR PDB; 1KKP; Highly similar; 10-JUL-02; SERINE HYDROXYMETHYLTRANSFERASE;
DR PDB; 1KL1; Highly similar; 10-JUL-02; SERINE HYDROXYMETHYLTRANSFERASE;
DR PDB; 1KL2; Highly similar; 10-JUL-02; SERINE HYDROXYMETHYLTRANSFERASE;
DR PDB; 1YJS; Highly similar; 31-MAY-05; SERINE HYDROXYMETHYLTRANSFERASE;
DR PDB; 1YJY; Highly similar; 31-MAY-05; SERINE HYDROXYMETHYLTRANSFERASE;
DR PDB; 1YJZ; Highly similar; 14-JUN-05; SERINE HYDROXYMETHYLTRANSFERASE;
DR KEGG; 2.1.2.1; Enzyme page
DR FFAS; 282590; Fold and function assignment.
DR TVPC; TM0720; Homologs in PDB, JCSG and SG center.
DR OVP; TM0720; Ortholog view popup.
DR TPM; TM0720; Target PDB monitor.
DR FSS; TM0720; Target function coverage.
PROPERTY Residues: 427 aa
Molecule Weight: 47455.19 Dalton
Isoelectric Point: 6.49
Extinction Coefficient: 33350
Gravy Index: -.27
Number of Met residues: 14
Percentage of Met residues: 3.28 %
Number of Cys residues: 4
Percentage of Cys residues: 0.94 %
SEQUENCE  amino acids 427 aa
>TM0720  TM0720 serine hydroxymethyltransferase (glyA)
MWKHVKQVDPEIYEVLVNELKRQEYGLELIASENFASLAVIETMGSMLTNKYAEGYPKKR
YYGGCEWVDRAEERAIERAKRLFGAKFANVQPHSGSQANMAVYLALAQPGDTIMGMSLSH
GGHLTHGAPVNFSGKIFKVVPYGVNLETETIDYDEVRRLALEHKPKIIVAGGSAYARIID
FKRFREIADEVGAYLMVDMAHFAGLVAAGIHPNPLEYAHVVTSTTHKTLRGPRGGLILTN
DPEIAKAVDKTIFPGIQGGPLMHVIAAKAVCFKEAMTEEFKEYQKQVVKNAKKMAEEFQK
RGYRIVSGGTDTHLFLVDLTPKDITGKAAEKALESCGITVNKNTIPNEKRSPFVASGIRI
GTPAVTTRGMKEEEMEEIAEMIDLVLSNVIDENGTVKPEVREEVSKKVRELCERFPLYRD
KIEGVEI

CDS  cDNA 1281 bp
   1 gtgtggaagc atgtaaaaca ggttgatccc gaaatatacg aagttcttgt gaacgagttg    60
  61 aagcgtcagg agtacggcct ggagctgatc gcctctgaga acttcgcgtc actcgctgtc   120
 121 atagaaacca tgggaagcat gctcaccaac aagtatgcgg aaggataccc gaagaagaga   180
 181 tactacggtg gctgcgagtg ggtggatcga gcagaagaac gtgctataga gagagcgaag   240
 241 aggttgtttg gagccaaatt tgcgaacgtt cagccgcact ccggttctca ggcgaacatg   300
 301 gcggtttatc tggcactcgc ccagcccgga gacacgatca tgggaatgtc cctgtcacac   360
 361 gggggacatc tcacccatgg agcaccggtg aatttctcag ggaagatctt caaggtggta   420
 421 ccttacggag tcaatctgga aacggaaacg atagattacg atgaggtcag aagactcgct   480
 481 ctggaacaca agccgaagat aatcgttgcg ggtggaagtg cttacgccag gatcatcgat   540
 541 ttcaaaagat tcagagagat agccgatgag gtgggagcat atttgatggt ggatatggct   600
 601 cactttgccg gactcgtcgc tgctggaatt catccaaatc ccttggaata cgcccacgtg   660
 661 gtgacttcca ccacacacaa gactctcagg ggccccagag gtggtttgat actcacgaac   720
 721 gatccggaga tcgccaaagc cgtggataaa actatcttcc ccggtatcca gggtggtcct   780
 781 ctcatgcacg tcatagcggc gaaagctgtc tgtttcaaag aagccatgac ggaggagttc   840
 841 aaagagtacc agaagcaggt ggtcaaaaat gctaaaaaga tggctgaaga gttccagaaa   900
 901 cgaggttaca ggatcgtttc tggaggaact gatacacacc tgttcctggt ggatctcaca   960
 961 ccaaaagaca taacgggtaa agcggcggaa aaggccctgg aaagctgtgg tatcacagtg  1020
1021 aacaaaaaca ccattcccaa cgaaaagaga tctccgttcg tggcgagcgg tatcagaata  1080
1081 ggaacacccg ctgttacaac ccgcggaatg aaggaagaag agatggaaga gatcgccgag  1140
1141 atgatagatc tggttctttc gaacgtgatc gatgaaaacg gaacggtgaa accagaggtg  1200
1201 agggaagagg tttcaaagaa ggtaagggag ctctgcgaaa ggtttcctct gtaccgtgac  1260
1261 aagatcgaag gggtggaaat a  1281
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
743000 744283 2 Glimmer3 score 12.17 good
Genemark probabilities .92   .82 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu