LOADING...
   TM0716;TM0716
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0716    TM0716            JCSG 282586 PDB Deposition 05-FEB-22              PDB id: 1vrg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0716
DESCRIPTIONAcetyl-coenzyme A carboxyl transferase (EC 6.4.1.2) / Propionyl-coenzyme A carboxyl transferase (EC 6.4.1.3) / Biotin:Acyl-CoA transcarboxylase chain
ORGANISMThermotoga maritima
COMMENTA component of the Acetyl-coenzyme A carboxylase carboxyl transferase (EC 6.4.1.2) complex involved in transfer of carboxygroup from biotin to Acetyl-CoA.
Evidence:
1. For detailed sequence comparative analysis of various biotin-dependent transcarboxylases see Reference,
2. Domain architecture: although a fusion of AccA and AccD-type domains is typical for bacterial Propionyl-coenzyme A carboxylase (whereas a two-subunit arrangement is characteristic of Acetyl-CoA-specific enzyme), it was shown that archaeal homologs of TM0716 are equally active with both substrates.
3. Genome context: forms an operon-like genomic cluster with Biotin Carboxyl Carrier Protein encoding gene (BCCP; TM0717). BCCP is an obligatory component of biotin-dependent transcarboxylase complexes (pathways).
4. Functional context: Acetyl-coenzyme A carboxylase function producing Malonyl-CoA is an absolutely required first step of the fatty acid biosynthesis in almost all bacteria and eukaryotes. All of the genes required for fatty acid biosynthesis (FAB) are found in T.maritima with a remarkable exception of Biotin-carboxylase ( AccC in E.coli, conserved in all forms of life)
5. Functional inference: Based on the comparative genome analysis, we suggest that T.maritima has an unusual Acetyl-CoA carboxylase complex/pathway, containing PycB-like subunit (TM0128) instead of standard Biotin carboxylase subunit. In this case, the carboxylation of biotin should be coupled to decarboxylation of oxaloacetate to pyruvate, instead of direct carboxylation by CO2 (as in the "classic" Acetyl-CoA carboxylase). Among ~ 200 complete bacterial genomes, only three more species (F.nucleatum, P.gingivalis and T.tencongensis) appear to lack Biotin carboxylase while having a functional FAB. Based on the presence of homologous genes, all of them may be able to replace a classic "CARBONATE:ACETYL-COA CARBOXYLASE" with the new hypothesized pathway: "OXALOACETATE:ACETYL-COA TRANSCARBOXYLASE".
DR UNIPROT; Q9WZH5_THEMA
DR SPTR; Q9WZH5 (flat text); Q9WZH5 (good view)
DR GenBank; AAD35798
DR Pfam; PF01039; Carboxyl_trans;
DR Interpro; IPR000022; Carboxyl_trans;
DR PDB; 1VRG; Identical; 08-MAR-05; PROPIONYL-COA CARBOXYLASE, BETA SUBUNIT;
DR PDB; 1XNW; Highly similar; 09-NOV-04; PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT;
DR PDB; 1XNV; Highly similar; 09-NOV-04; PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT;
DR PDB; 1XNY; Highly similar; 09-NOV-04; PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT;
DR PDB; 1XO6; Highly similar; 09-NOV-04; PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT;
DR PDB; 3IB9; Highly similar; 02-JUN-10; PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT;
DR PDB; 3IBB; Highly similar; 02-JUN-10; PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT;
DR PDB; 3IAV; Highly similar; 30-JUN-10; PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT;
DR KEGG; 6.4.1.2/6.4.1.3; Enzyme page
DR FFAS; 282586; Fold and function assignment.
DR TVPC; TM0716; Homologs in PDB, JCSG and SG center.
DR OVP; TM0716; Ortholog view popup.
DR TPM; TM0716; Target PDB monitor.
DR FSS; TM0716; Target function coverage.
PROPERTY Residues: 515 aa
Molecule Weight: 56411.83 Dalton
Isoelectric Point: 5.64
Extinction Coefficient: 34840
Gravy Index: -.14
Number of Met residues: 13
Percentage of Met residues: 2.52 %
Number of Cys residues: 2
Percentage of Cys residues: 0.39 %
SEQUENCE  amino acids 515 aa
>TM0716  TM0716 propionyl-CoA carboxylase, beta subunit (pccB)
MSLRDKIEELKKIEKEIEQGGGPEKVEKQHRAGKLTAWERLELLLDPGTFVEIDKFVEHR
NTYFGLDKVKLPRDGVITGVGEINGRKVAVFSQDFTVMGGSLGEMHAKKIVKLLDLALKM
GIPVIGINDSGGARIQEGVDALAGYGEIFLRNTLASGVVPQITVIAGPCAGGAVYSPALT
DFIVMVDQTARMFITGPNVIKAVTGEEISQEDLGGAMVHNQKSGNAHFLADNDEKAMSLV
RTLLSYLPSNNAEEPPVEDPDTSLETPEDILDILPDNPNKGYDVRDVIKRVVDHGEFFEV
QPYFAKNIVIGFARIQGKTVGIVANQPSVLAGVLDIDSSDKAARFIRFLDAFNIPILTFV
DTPGYLPGVAQEHGGIIRHGAKLLYAYSEATVPKITVILRKAYGGAYIAMGSKHLGADMV
LAWPSAEIAVMGPEGAANIIFKREIEASSNPEETRRKLIEEYKQQFANPYIAASRGYVDM
VIDPRETRKYIMRALEVCETKVEYRPKKKHGNIPL

CDS  cDNA 1545 bp
   1 atgagtctga gggataagat cgaagaattg aagaaaattg agaaagagat tgaacagggt    60
  61 ggcggtcctg agaaagtaga aaagcagcat agagctggaa aactcaccgc ctgggaaagg   120
 121 ttagaactgc tccttgatcc aggaacgttc gtggagatcg acaagttcgt ggaacacaga   180
 181 aacacgtact ttggactcga caaggtgaaa cttccaaggg atggagtcat tacaggtgtg   240
 241 ggagagataa acggaagaaa agtcgccgtt ttctcccagg acttcacggt gatgggcggt   300
 301 tcacttggag aaatgcacgc aaagaagatt gtaaagctcc tcgatctggc cctcaagatg   360
 361 ggaatacctg tgatcggtat aaacgattct ggaggcgcac gaattcagga aggtgtggat   420
 421 gcactcgccg gttacggcga aatatttttg aggaacaccc tcgcttccgg tgtggtgccg   480
 481 cagatcaccg tgatagctgg tccctgtgct ggtggggctg tctattctcc cgccctcacc   540
 541 gatttcatcg tgatggtaga ccagaccgcc aggatgttca taacggggcc gaacgtgata   600
 601 aaggcggtga cgggtgaaga gatctcccaa gaggatctgg gaggtgccat ggttcacaat   660
 661 cagaagagtg gaaacgctca ctttctggca gacaacgatg aaaaagccat gtctctggtg   720
 721 agaacacttc tttcgtacct tccctccaac aacgccgaag aaccacccgt tgaggatccc   780
 781 gataccagtc tggaaactcc agaggacatt ctcgatatcc ttccggacaa tccgaacaag   840
 841 ggatacgatg tgagagatgt catcaaaaga gtagtggatc acggggagtt cttcgaggtt   900
 901 cagccttact ttgcaaagaa catcgtcata ggctttgcca gaatccaggg aaagacagtg   960
 961 ggaatagtgg cgaatcagcc ttccgtactc gccggtgttc tggatatcga ttcctccgac  1020
1021 aaagcggcgc gtttcatcag gttcctcgac gccttcaata ttcctattct gaccttcgtg  1080
1081 gacacccccg gttatctccc cggtgtcgct caggaacacg gcggtatcat aagacacgga  1140
1141 gcgaagctgc tctacgcgta cagcgaggca acggtcccga agatcacggt cattctccga  1200
1201 aaggcctatg gaggagcgta catcgccatg gggagcaaac atctgggggc ggatatggtg  1260
1261 cttgcctggc cgtccgccga gatcgcagtc atggggcctg aaggcgcagc gaatattatc  1320
1321 ttcaaaaggg aaatagaggc ttcttccaat ccagaagaaa cgagaagaaa gctcatcgaa  1380
1381 gaatacaaac agcagttcgc gaatccgtac atagcggcga gcagaggata cgtagacatg  1440
1441 gtgatagatc cgagagagac aagaaaatac ataatgaggg cacttgaagt ctgcgaaact  1500
1501 aaggttgagt acagaccgaa gaaaaagcat ggaaacatcc ctctg  1545
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
738881 740428 2 Glimmer3 score 13.29 good
Genemark probabilities .94   .95 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu