LOADING...
   TM0693;TM0693
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0693    TM0693            JCSG 360368 PDB Deposition 06-FEB-21              PDB id: 2fzt, 2g42

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0693
DESCRIPTIONPutative RNA binding protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZF7_THEMA
DR SPTR; Q9WZF7 (flat text); Q9WZF7 (good view)
DR GenBank; AAD35775
DR PDB; 2G42; Identical; 07-MAR-06; HYPOTHETICAL PROTEIN TM_0693;
DR PDB; 2FZT; Identical; 21-MAR-06; HYPOTHETICAL PROTEIN TM0693;
DR FFAS; 282563; Fold and function assignment.
DR TVPC; TM0693; Homologs in PDB, JCSG and SG center.
DR OVP; TM0693; Ortholog view popup.
DR TPM; TM0693; Target PDB monitor.
DR FSS; TM0693; Target function coverage.
PROPERTY Residues: 90 aa
Molecule Weight: 10682.75 Dalton
Isoelectric Point: 6.38
Extinction Coefficient: 6990
Gravy Index: -.91
Number of Met residues: 2
Percentage of Met residues: 2.22 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 90 aa
>TM0693  TM0693 hypothetical protein
MNIDEIERKIDEAIEKEDYETLLSLLNKRKELMEGLPKDKLSEILEKDRKRLEIIEKRKT
ALFQEINVIREARSSLQKNIWTRGDTLGRG

CDS  cDNA 270 bp
   1 atgaacatcg atgagataga aagaaaaata gacgaagcga ttgagaagga agactatgaa    60
  61 acgcttcttt ctcttttgaa taaaaggaaa gagttgatgg aaggactccc aaaggacaaa   120
 121 ctgtctgaga tccttgaaaa ggacagaaaa agattggaaa tcatcgaaaa gagaaagaca   180
 181 gcgctttttc aggagatcaa tgttatcaga gaagccagat cgtctcttca aaagaacata   240
 241 tggaccagag gagatacctt agggagagga   270
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
717922 718194 1 Glimmer3 score 16.08 good
Genemark probabilities .72   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu