LOADING...
   TM0680;TM0680
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0680    TM0680            JCSG 356088 PDB Deposition 03-OCT-24              PDB id: 1o6a

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0680
DESCRIPTIONthe C-terminal fragment of the putative flagellar motor switch protein FliN
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF01052; SpoA;
DR Pfam; PF04509; CheC;
DR PDB; 4HYN; Identical; 03-APR-13; CHEC, INHIBITOR OF MCP METHYLATION / FLIN FUSION CHAIN: A, B;
DR PDB; 1O6A; Identical; 11-NOV-03; PUTATIVE FLAGELLAR MOTOR SWITCH PROTEIN FLIN;
DR PDB; 1YAB; Identical; 07-JUN-05; CHEMOTAXIS PROTEIN;
DR FFAS; 354150; Fold and function assignment.
DR TVPC; TM0680; Homologs in PDB, JCSG and SG center.
DR OVP; TM0680; Ortholog view popup.
DR TPM; TM0680; Target PDB monitor.
DR FSS; TM0680; Target function coverage.
PROPERTY Residues: 343 aa
Molecule Weight: 37954.73 Dalton
Isoelectric Point: 4.56
Extinction Coefficient: 5960
Gravy Index: -.18
Number of Met residues: 14
Percentage of Met residues: 4.08 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 343 aa
>TM0680  TM0680 Corrected gene protein product
MTENEFLSQEEIDKLLSDSDTGGVLTPEEKDMIGEIGNIAMGSAATTLSMILGRDIHITV
PTVREEKMKNVKSDFSGEQVVVSVEYTEGLEGLNVLVLDKKLVAVIADLMMGGSGEVETE
ELDEIKLSAVGEAMNQMMGSAATSLSELLGITINISPPKVEILNFDDPNTQFPPVTDNPE
KDVAVVEFEMEIEGLPKSKFYQVISADLVKKMYEYFTKKQSEAAEKKEKKEEKKVKVEPV
EFAELKPSETRKTEVPSDKLELLLDIPLKVTVELGRTRMTLKRVLEMIPGSIIELDKLTG
EPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

CDS  cDNA 1029 bp
   1 atgacggaaa atgaattcct ctctcaggaa gagatagaca agcttcttag cgattctgat    60
  61 accggtggtg tcctcactcc cgaagaaaag gacatgatag gcgagatagg aaacatcgca   120
 121 atggggagtg ctgcaacgac gctctcgatg atcctcggaa gggatattca catcaccgtt   180
 181 ccaactgttc gggaagaaaa gatgaagaac gtcaagagtg acttcagtgg tgagcaggta   240
 241 gtggtgagtg tggaatacac ggaggggctc gaaggtttga acgttcttgt cctcgataaa   300
 301 aaactcgtgg cggtgatagc tgacctcatg atggggggaa gtggagaggt agaaaccgag   360
 361 gaattggacg aaatcaaact cagcgcggtt ggagaagcga tgaatcagat gatgggaagc   420
 421 gctgcaacat cgctttctga acttctggga ataaccatca atatatctcc cccgaaagtg   480
 481 gagatattga atttcgatga tcctaacaca cagtttccac cggtaaccga caatccggag   540
 541 aaagatgttg ccgttgtcga attcgaaatg gagatagagg gacttccgaa gtcgaagttc   600
 601 taccaggtga taagcgccga tctggtgaag aagatgtacg agtatttcac gaaaaaacaa   660
 661 tccgaagcag ctgagaaaaa agagaagaaa gaggagaaaa aggtgaaggt cgaaccggta   720
 721 gaattcgcag agctgaaacc ttctgaaacc agaaaaaccg aagtgccgag tgacaagctg   780
 781 gaactgcttc tcgatattcc tctcaaagtc acagtggaac ttggaagaac gcgaatgact   840
 841 ctgaaacggg ttctggaaat gatccctggc tccataatag agctggacaa actcacgggg   900
 901 gaacctgtgg atatcctcgt gaacggaaag ctcatcgccc gcggagaagt tgtcgtgata   960
 961 gatgaaaact ttggggtgag gataacagag atcgtgagtc caaaagagag gctcgagctt  1020
1021 ctcaacgaa  1029
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu