LOADING...
   TM0667;TM0667
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0667    TM0667            JCSG 282539 PDB Deposition 02-JUL-09              PDB id: 1j6o

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0667
DESCRIPTIONTatD-related deoxyribonuclease
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZD5_THEMA
DR SPTR; Q9WZD5 (flat text); Q9WZD5 (good view)
DR GenBank; AAD35749
DR Pfam; PF01026; TatD_DNase;
DR Interpro; IPR001130; TatD_DNase;
DR PDB; 1J6O; Identical; 30-OCT-02; TATD-RELATED DEOXYRIBONUCLEASE;
DR PDB; 2GZX; Highly similar; 11-JUL-06; PUTATIVE TATD RELATED DNASE;
DR PDB; 1YIX; Highly similar; 25-JAN-05; DEOXYRIBONUCLEASE YCFH;
DR PDB; 1XWY; Highly similar; 25-JAN-05; DEOXYRIBONUCLEASE TATD;
DR PDB; 4PE8; Highly similar; 27-AUG-14; TAT-LINKED QUALITY CONTROL PROTEIN TATD;
DR PDB; 4P5U; Highly similar; 27-AUG-14; TAT-LINKED QUALITY CONTROL PROTEIN TATD;
DR KEGG; 3.1.21.-; Enzyme page
DR FFAS; 282539; Fold and function assignment.
DR TVPC; TM0667; Homologs in PDB, JCSG and SG center.
DR OVP; TM0667; Ortholog view popup.
DR TPM; TM0667; Target PDB monitor.
DR FSS; TM0667; Target function coverage.
PROPERTY Residues: 256 aa
Molecule Weight: 29179.67 Dalton
Isoelectric Point: 5.23
Extinction Coefficient: 15930
Gravy Index: -.31
Number of Met residues: 1
Percentage of Met residues: 0.39 %
Number of Cys residues: 2
Percentage of Cys residues: 0.78 %
SEQUENCE  amino acids 256 aa
>TM0667  TM0667 conserved hypothetical protein
MVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSVG
VHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKL
NLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYP
KNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVD
EATTENARRIFLEVKE

CDS  cDNA 768 bp
   1 atggtggaca cacacgcgca tcttcatttt caccagttcg acgacgacag aaacgctgtc    60
  61 atctccagct ttgaagagaa caacatcgaa ttcgtggtga acgtgggtgt gaacctcgaa   120
 121 gattcgaaga aatccctcga tctttcaaag acaagtgatc gcattttctg ttctgtgggt   180
 181 gtacatccgc acgacgcgaa ggaagttccc gaggatttca tagaacatct cgaaaaattc   240
 241 gcgaaagatg aaaaggtggt cgccataggt gagaccggac tcgatttctt caggaacatc   300
 301 tctccagctg aagtccagaa aagggtcttc gttgaacaga tcgaactcgc aggaaagttg   360
 361 aaccttcccc tcgttgttca catcagggac gcgtacagcg aggcgtacga gatactcaga   420
 421 acagaatcac ttccggagaa gcggggtgtg attcacgctt tttcttcgga ttacgagtgg   480
 481 gcgaagaagt tcatagacct cggttttctg cttggaatag gaggtcctgt gacgtatccg   540
 541 aagaacgagg ctctgaggga agtggttaaa agagtgggcc ttgaatacat cgttctggag   600
 601 acggactgtc cttttcttcc accacagccg ttcaggggaa aaagaaacga accgaagtac   660
 661 ttgaagtacg tcgtggaaac aatctcgcag gtgctgggtg tgcctgaagc gaaagtggat   720
 721 gaggcgacca cagagaacgc cagaaggatc tttctggagg tgaaggaa   768
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
695064 695834 3 Glimmer3 score 15.67 good
Genemark probabilities .9   .75 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu