LOADING...
   TM0665;TM0665
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0665    TM0665            JCSG 282537 PDB Deposition 03-AUG-20              PDB id: 1o58

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0665
DESCRIPTIONO-acetylserine sulfhydrylase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZD3_THEMA
DR SPTR; Q9WZD3 (flat text); Q9WZD3 (good view)
DR GenBank; AAD35748
DR Pfam; PF00291; PALP;
DR Interpro; IPR001926; B6_enzyme_beta;
DR Interpro; IPR001216; Cys_synthase_BS;
DR Interpro; IPR005859; Cys_synthK;
DR Interpro; IPR005856; Cys_synthKM;
DR PDB; 1O58; Identical; 02-SEP-03; O-ACETYLSERINE SULFHYDRYLASE;
DR PDB; 3FCA; Identical; 17-FEB-09; CYSTEINE SYNTHASE;
DR PDB; 1VE1; Highly similar; 19-APR-05; O-ACETYLSERINE SULFHYDRYLASE;
DR PDB; 2ECO; Highly similar; 19-FEB-08; O-ACETYLSERINE (THIOL)-LYASE;
DR PDB; 2ECQ; Highly similar; 19-FEB-08; O-ACETYLSERINE (THIOL)-LYASE;
DR PDB; 2EFY; Highly similar; 26-FEB-08; O-ACETYLSERINE (THIOL)-LYASE;
DR PDB; 2EGU; Highly similar; 04-SEP-07; CYSTEINE SYNTHASE;
DR PDB; 4LMA; Highly similar; 04-JUN-14; CYSTEINE SYNTHASE;
DR KEGG; 2.5.1.47; Enzyme page
DR FFAS; 282537; Fold and function assignment.
DR TVPC; TM0665; Homologs in PDB, JCSG and SG center.
DR OVP; TM0665; Ortholog view popup.
DR TPM; TM0665; Target PDB monitor.
DR FSS; TM0665; Target function coverage.
PROPERTY Residues: 291 aa
Molecule Weight: 31128.65 Dalton
Isoelectric Point: 8.92
Extinction Coefficient: 8940
Gravy Index: .04
Number of Met residues: 12
Percentage of Met residues: 4.12 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 291 aa
>TM0665  TM0665 cysteine synthase (cysK)
MMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPT
SGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALE
ISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKG
FFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEM
ARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL

CDS  cDNA 873 bp
   1 atgatggaaa gactgatagg gagcactcct atagtgagac tcgattcgat agactcgaga    60
  61 atcttcttga aactggaaaa gaataatccc ggtggtagtg taaaagacag acccgccctc   120
 121 ttcatgattc tcgacgcaga gaaaagagga ctcctcaaga acggtatcgt ggaaccaacg   180
 181 agcggcaaca tgggaatcgc catagcgatg atcggagcaa agagaggaca cagggtgatc   240
 241 ctcacgatgc ccgaaaccat gagcgttgag agaagaaagg tcctgaaaat gctcggagca   300
 301 gaactcgttc tcacaccagg ggaactggga atgaaaggtg cggtggaaaa ggcgctcgag   360
 361 atatccagag aaaccggcgc gcacatgctc aaccagttcg aaaaccccta caacgtctac   420
 421 tctcaccagt tcactacagg tccggagatc ctcaaacaga tggactatca gatagacgcc   480
 481 ttcgtcgcgg gagtgggaac gggaggcacg atcagcggag tgggaagggt tttgaaaggc   540
 541 ttctttggaa acggagtgaa gatagtagcg gtagagcccg caaaatctcc cgttctctct   600
 601 ggaggccagc cgggaaaaca cgccatccag ggtataggag cgggctttgt tccgaagatc   660
 661 ctggacagat ccgtgataga cgaagtgatc accgtggagg acgaagaggc ctacgagatg   720
 721 gcgaggtacc tcgcaaaaaa agagggactt ctcgtaggga tctcttccgg tgccaacgtc   780
 781 gcagccgctt tgaaagtagc ccagaaactc gggccagacg cgagggttgt gaccgttgca   840
 841 ccggaccacg cggaaagata cctgagtatc cta   873
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
693448 694323 -1 Glimmer3 score - -
Genemark probabilities .91   .9 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu