LOADING...
   TM0658;TM0658
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0658    TM0658            JCSG 282530 PDB Deposition 11-MAR-04              PDB id: 2amu, 3qzb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0658
DESCRIPTIONPutative superoxide reductase [Superoxide reductase-like]
ORGANISMThermotoga maritima
COMMENT(EC 1.15.1.2) (SOR).

-!- FUNCTION: USES ELECTRONS FROM REDUCED NADP, BY WAY OF RUBREDOXIN
AND AN OXIDOREDUCTASE, TO CATALYZE THE REDUCTION OF SUPEROXIDE TO
HYDROGEN PEROXIDE (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: REDUCED RUBREDOXIN + SUPEROXIDE + 2 H(+) =
RUBREDOXIN + H(2)O(2).
-!- COFACTOR: IRON (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE DESULFOFERRODOXIN FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------

Fold assigned according to fastScop b.1.13 (d1dqia, E-val 4e-42)
DR UNIPROT; SOR_THEMA
DR SPTR; Q9WZC6 (flat text); Q9WZC6 (good view)
DR GenBank; AAD35742
DR Pfam; PF01880; Desulfoferrodox;
DR Interpro; IPR002742; Desulfoferrodox;
DR PDB; 2AMU; Identical; 23-AUG-05; PUTATIVE SUPEROXIDE REDUCTASE;
DR PDB; 3QZB; Identical; 30-MAR-11; PUTATIVE SUPEROXIDE REDUCTASE;
DR PDB; 1DO6; Highly similar; 24-MAR-00; SUPEROXIDE REDUCTASE;
DR PDB; 1DQI; Highly similar; 10-MAY-00; SUPEROXIDE REDUCTASE;
DR PDB; 1DQK; Highly similar; 10-MAY-00; SUPEROXIDE REDUCTASE;
DR PDB; 4BFF; Highly similar; 26-MAR-14; SUPEROXIDE REDUCTASE;
DR PDB; 4BGL; Highly similar; 09-APR-14; SUPEROXIDE REDUCTASE;
DR PDB; 4BFK; Highly similar; 26-MAR-14; SUPEROXIDE REDUCTASE;
DR KEGG; 1.15.1.2; Enzyme page
DR FFAS; 282530; Fold and function assignment.
DR TVPC; TM0658; Homologs in PDB, JCSG and SG center.
DR OVP; TM0658; Ortholog view popup.
DR TPM; TM0658; Target PDB monitor.
DR FSS; TM0658; Target function coverage.
PROPERTY Residues: 131 aa
Molecule Weight: 14934.32 Dalton
Isoelectric Point: 6.07
Extinction Coefficient: 18450
Gravy Index: -.48
Number of Met residues: 1
Percentage of Met residues: 0.76 %
Number of Cys residues: 1
Percentage of Cys residues: 0.76 %
SEQUENCE  amino acids 131 aa
>TM0658  TM0658 neelaredoxin
MKLSDFIKTEDFKKEKHVPVIEAPEKVKKDEKVQIVVTVGKEIPHPNTTEHHIRWIKVFF
QPDGDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVKLNRSGTIIALSYCNIHGL
WESSQKITVEE

CDS  cDNA 393 bp
   1 atgaaacttt ctgatttcat caagacggaa gatttcaaga aggaaaagca cgttccggtc    60
  61 atagaagcac ccgagaaggt gaaaaaagac gaaaaagttc aaatcgtggt taccgtggga   120
 121 aaggagatcc cgcacccgaa cacaacagaa caccacatca ggtggatcaa agttttcttc   180
 181 caacctgatg gtgatccata cgtttacgag gtgggaaggt acgagttcaa cgcgcacgga   240
 241 gagtccgttc aggggccgaa catcggcgct gtttacacag agcctactgt cacaaccgtg   300
 301 gtaaaattga acagatcggg aacgatcata gccctctcct actgcaacat acacggcctc   360
 361 tgggaaagca gtcaaaagat cactgttgaa gag   393
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
688787 689182 2 Glimmer3 score 12.51 good
Genemark probabilities .8   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu