LOADING...
   TM0655;TM0655
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0655    TM0655            JCSG 282527 PDB Deposition 05-FEB-15              PDB id: 1vr7

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0655
DESCRIPTIONS-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50) (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase beta chain; S- adenosylmethionine decarboxylase alpha chain].
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: DECARBOXYLATION OF S-ADENOSYLMETHIONINE PROVIDES THE
AMINOPROPYL MOIETY REQUIRED FOR SPERMIDINE BIOSYNTHESIS FROM
PUTRESCINE (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: S-ADENOSYL-L-METHIONINE = (5-DEOXY-5-
ADENOSYL)(3-AMINOPROPYL) METHYLSULFONIUM SALT + CO(2).
-!- COFACTOR: PYRUVOYL GROUP (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE PROKARYOTIC ADOMETDC FAMILY. SUBFAMILY
1.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; SPEH_THEMA
DR SPTR; Q9WZC3 (flat text); Q9WZC3 (good view)
DR GenBank; AAD35739
DR Pfam; PF02675; AdoMet_dc;
DR Interpro; IPR003826; SAMDC;
DR PDB; 1TLU; Identical; 29-JUN-04; S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME, ADOMETDC, SAMD;
DR PDB; 1VR7; Identical; 15-MAR-05; S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME;
DR PDB; 1TMI; Identical; 29-JUN-04; S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME, ADOMETDC, SAMD;
DR PDB; 3IWB; Identical; 09-FEB-10; S-ADENOSYLMETHIONINE DECARBOXYLASE;
DR PDB; 3IWC; Identical; 09-FEB-10; S-ADENOSYLMETHIONINE DECARBOXYLASE;
DR PDB; 3IWD; Identical; 09-FEB-10; S-ADENOSYLMETHIONINE DECARBOXYLASE;
DR PDB; 2III; Highly similar; 09-OCT-07; S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME;
DR KEGG; 4.1.1.50; Enzyme page
DR FFAS; 282527; Fold and function assignment.
DR TVPC; TM0655; Homologs in PDB, JCSG and SG center.
DR OVP; TM0655; Ortholog view popup.
DR TPM; TM0655; Target PDB monitor.
DR FSS; TM0655; Target function coverage.
PROPERTY Residues: 130 aa
Molecule Weight: 14784 Dalton
Isoelectric Point: 5.56
Extinction Coefficient: 19940
Gravy Index: -.32
Number of Met residues: 2
Percentage of Met residues: 1.54 %
Number of Cys residues: 2
Percentage of Cys residues: 1.54 %
SEQUENCE  amino acids 130 aa
>TM0655  TM0655 conserved hypothetical protein
MKSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVI
SESHLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEIGI
PEDSPHKAAV

CDS  cDNA 390 bp
   1 atgaagagtc tgggaaggca cctggtggcg gaattctacg aatgtgacag agaggttctt    60
  61 gacaacgtgc agctgataga acaggagatg aagcaggcag cctatgaaag tggagcaaca   120
 121 atagtcacgt caacgtttca caggttcctc ccctatgggg tgagtggtgt ggtggtgata   180
 181 tctgaatccc acctaaccat tcacacctgg ccagagtacg ggtacgctgc tatcgatctc   240
 241 ttcacctgcg gagaggatgt cgatccctgg aaagccttcg aacatctgaa aaaagcgctg   300
 301 aaggcaaaga gagttcacgt ggtggagcat gaaagaggca ggtacgacga gataggaatc   360
 361 ccggaggact cgccgcacaa ggccgccgtc   390
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
687033 687425 -3 Glimmer3 score 9.76 poor
Genemark probabilities .8   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu