LOADING...
   TM0613;TM0613
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0613    TM0613            JCSG 282486 PDB Deposition 03-MAR-28              PDB id: 1o3u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0613
DESCRIPTIONNucleotide binding domain (HEPN) of the two-protein nucleotidyl transferase complex
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZ82_THEMA
DR SPTR; Q9WZ82 (flat text); Q9WZ82 (good view)
DR GenBank; AAD35698
DR Pfam; PF05168; HEPN;
DR Interpro; IPR007842; HEPN;
DR PDB; 1O3U; Identical; 22-APR-03; CONSERVED HYPOTHETICAL PROTEIN TM0613;
DR PDB; 1UFB; Highly similar; 28-NOV-03; TT1696 PROTEIN;
DR PDB; 1WOL; Highly similar; 22-NOV-05; 122AA LONG CONSERVED HYPOTHETICAL PROTEIN;
DR FFAS; 282486; Fold and function assignment.
DR TVPC; TM0613; Homologs in PDB, JCSG and SG center.
DR OVP; TM0613; Ortholog view popup.
DR TPM; TM0613; Target PDB monitor.
DR FSS; TM0613; Target function coverage.
PROPERTY Residues: 123 aa
Molecule Weight: 14094.09 Dalton
Isoelectric Point: 5.17
Extinction Coefficient: 18450
Gravy Index: -.51
Number of Met residues: 3
Percentage of Met residues: 2.44 %
Number of Cys residues: 3
Percentage of Cys residues: 2.44 %
SEQUENCE  amino acids 123 aa
>TM0613  TM0613 conserved hypothetical protein
MDAAKDDLEHAKHDLEHGFYNWACFSSQQAAEKAVKAVFQRMGAQAWGYSVPDFLGELSS
RFEIPEELMDHALELDKACIPTRYPDALPSGSPRNRYSRIEAERLVNYAEKIIRFCEDLL
SRI

CDS  cDNA 369 bp
   1 ttggatgcgg caaaagatga tctggagcat gcaaaacacg atttggagca cggcttctac    60
  61 aactgggcat gcttttcttc ccagcaggca gcagaaaaag ccgtgaaagc tgtgttccag   120
 121 agaatgggtg cacaggcatg gggatattct gtaccggatt ttctcgggga actctccagc   180
 181 cgttttgaaa tccctgaaga actcatggac catgcccttg aactggacaa agcttgtatc   240
 241 cccacaaggt atccggatgc ccttccttcc ggctccccca gaaacaggta ttccagaatt   300
 301 gaagccgaaa ggctggtgaa ctatgctgaa aagatcatcc gattctgcga agatcttcta   360
 361 tccagaata   369
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu