LOADING...
   TM0604;TM0604
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0604    TM0604            JCSG 282477 PDB Deposition 05-APR-01              PDB id: 1z9f

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0604
DESCRIPTIONSingle stranded DNA-binding protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; SSB_THEMA
DR SPTR; Q9WZ73 (flat text); Q9WZ73 (good view)
DR GenBank; AAD35689
DR Pfam; PF00436; SSB;
DR Interpro; IPR000424; SSB_protein;
DR PDB; 1Z9F; Identical; 12-APR-05; SINGLE-STRAND BINDING PROTEIN;
DR PDB; 1SRU; Highly similar; 03-AUG-04; SINGLE-STRAND BINDING PROTEIN;
DR PDB; 1EYG; Highly similar; 01-AUG-00; SINGLE-STRAND DNA-BINDING PROTEIN;
DR PDB; 1KAW; Highly similar; 31-DEC-97; SINGLE-STRANDED DNA BINDING PROTEIN;
DR PDB; 1QVC; Highly similar; 05-JUN-00; SINGLE STRANDED DNA BINDING PROTEIN MONOMER;
DR PDB; 1EQQ; Highly similar; 23-SEP-03; SINGLE STRANDED DNA BINDING PROTEIN;
DR PDB; 4MZ9; Highly similar; 18-DEC-13; SINGLE-STRANDED DNA-BINDING PROTEIN;
DR PDB; 3TQY; Highly similar; 21-SEP-11; SINGLE-STRANDED DNA-BINDING PROTEIN;
DR FFAS; 282477; Fold and function assignment.
DR TVPC; TM0604; Homologs in PDB, JCSG and SG center.
DR OVP; TM0604; Ortholog view popup.
DR TPM; TM0604; Target PDB monitor.
DR FSS; TM0604; Target function coverage.
PROPERTY Residues: 141 aa
Molecule Weight: 16297.55 Dalton
Isoelectric Point: 4.8
Extinction Coefficient: 8480
Gravy Index: -.52
Number of Met residues: 4
Percentage of Met residues: 2.84 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 141 aa
>TM0604  TM0604 single stranded DNA-binding protein, putative
MSFFNKIILIGRLVRDPEERYTLSGTPVTTFTIAVDRVPRKNAPDDAQTTDFFRIVTFGR
LAEFARTYLTKGRLVLVEGEMRMRRWETPTGEKRVSPEVVANVVRFMDRKPAETVSETEE
ELEIPEEDFSSDTFSEDEPPF

CDS  cDNA 423 bp
   1 atgtctttct tcaacaagat catactcata ggaagactcg tgagagatcc cgaagagaga    60
  61 tacacgctca gcggaactcc agtcaccacc ttcaccatag cggtggacag ggttcccaga   120
 121 aagaacgcgc cggacgacgc tcaaacgact gatttcttca ggatcgtcac ctttggaaga   180
 181 ctggcagagt tcgctagaac ctatctcacc aaaggaaggc tcgttctcgt cgaaggtgaa   240
 241 atgagaatga gaagatggga aacacccact ggagaaaaga gggtatctcc ggaggttgtc   300
 301 gcaaacgttg ttagattcat ggacagaaaa cctgctgaaa cagttagcga gactgaagag   360
 361 gagctggaaa taccggaaga agacttttcc agcgatacct tcagtgaaga tgaaccacca   420
 421 ttt   423
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
638311 638736 1 Glimmer3 score 13.04 good
Genemark probabilities .83   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu