LOADING...
   TM0603;TM0603
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0603    TM0603            JCSG 282476 PDB Deposition 04-SEP-16              PDB id: 1vmb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0603
DESCRIPTION30S ribosomal protein S6.
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: BINDS TOGETHER WITH S18 TO 16S RIBOSOMAL RNA (BY
SIMILARITY).
-!- SIMILARITY: BELONGS TO THE S6P FAMILY OF RIBOSOMAL PROTEINS.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; RS6_THEMA
DR SPTR; Q9WZ72 (flat text); Q9WZ72 (good view)
DR GenBank; AAD35688
DR Pfam; PF01250; Ribosomal_S6;
DR Interpro; IPR000529; Ribosomal_S6;
DR PDB; 1VMB; Identical; 05-OCT-04; 30S RIBOSOMAL PROTEIN S6;
DR PDB; 2J5A; Highly similar; 25-OCT-06; 30S RIBOSOMAL PROTEIN S6;
DR PDB; 3R3T; Highly similar; 30-MAR-11; 30S RIBOSOMAL PROTEIN S6;
DR FFAS; 282476; Fold and function assignment.
DR TVPC; TM0603; Homologs in PDB, JCSG and SG center.
DR OVP; TM0603; Ortholog view popup.
DR TPM; TM0603; Target PDB monitor.
DR FSS; TM0603; Target function coverage.
PROPERTY Residues: 128 aa
Molecule Weight: 15368.73 Dalton
Isoelectric Point: 5.81
Extinction Coefficient: 14440
Gravy Index: -.95
Number of Met residues: 4
Percentage of Met residues: 3.12 %
Number of Cys residues: 1
Percentage of Cys residues: 0.78 %
SEQUENCE  amino acids 128 aa
>TM0603  TM0603 ribosomal protein S6 (rpsF)
MAYVKERIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKFAYEIKK
FNEGDYTVIYFRCDGQNLQELENFYRVTPEIIRWQTFRRFDLEKKERKAQREKAAAEATE
SSEGGSED

CDS  cDNA 384 bp
   1 gtggcttacg tgaaagagag gatctacgag agcatgttca tcatcgcacc gaacgttcca    60
  61 gaggaagaga gagaaaatct cgtcgaaaga gtcaagaaga tcatcgaaga aagggtcaag   120
 121 ggaaagatcg acaaagtgga aaggatgggt atgagaaagt tcgcctacga gatcaagaag   180
 181 ttcaacgaag gagactacac ggtgatctac ttcaggtgcg atggtcagaa ccttcaggag   240
 241 ctggaaaact tctacagagt gacgcccgag atcatcagat ggcagacctt cagaaggttc   300
 301 gacctggaaa agaaagagag aaaggcgcag agagaaaaag cagctgctga agctaccgag   360
 361 tcgagtgaag gaggatccga agat   384
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
637925 638311 2 Glimmer3 score 18.62 good
Genemark probabilities .88   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu