LOADING...
   TM0581;TM0581
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0581    TM0581            JCSG 282454 PDB Deposition 07-JUN-06              PDB id: 2q78

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0581
DESCRIPTIONPutative thioesterase TM0581.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZ50_THEMA
DR SPTR; Q9WZ50 (flat text); Q9WZ50 (good view)
DR GenBank; AAD35666
DR PDB; 2Q78; Identical; 19-JUN-07; UNCHARACTERIZED PROTEIN;
DR FFAS; 282454; Fold and function assignment.
DR TVPC; TM0581; Homologs in PDB, JCSG and SG center.
DR OVP; TM0581; Ortholog view popup.
DR TPM; TM0581; Target PDB monitor.
DR FSS; TM0581; Target function coverage.
PROPERTY Residues: 141 aa
Molecule Weight: 15866.72 Dalton
Isoelectric Point: 6.31
Extinction Coefficient: 9970
Gravy Index: .14
Number of Met residues: 5
Percentage of Met residues: 3.55 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 141 aa
>TM0581  TM0581 hypothetical protein
MMDFDFLEGKRLTEDVALDETMVWNEDIEMLDLHLVATSALIGVVHRVSYELLSRYLPND
YTAVVVETLARHVKAVPTGTRVAVGVRVVGVVGNRVKFRGIVMSGDEKILEAEFVRAIVP
REKLRRLALEKAEKTSRLFGI

CDS  cDNA 423 bp
   1 atgatggatt ttgatttcct tgaggggaaa aggcttacgg aagacgtggc tctcgatgaa    60
  61 actatggtgt ggaacgaaga catcgagatg cttgatctcc atctcgtcgc gacttcagcc   120
 121 ctgatagggg tagttcacag agtgtcgtac gagctgttga gcaggtacct tcccaacgat   180
 181 tacacggctg ttgtggtgga gaccctggca agacacgtga aggctgttcc aacgggaacg   240
 241 agagttgctg ttggtgtcag ggtggttgga gttgtgggaa acagggtgaa gttcagagga   300
 301 atcgtgatga gcggtgacga aaagatactg gaggctgaat tcgtcagagc gatagttccc   360
 361 agggaaaagc tccggaggtt agcccttgag aaggccgaga agacctcaag actttttgga   420
 421 ata   423
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
614634 615059 3 Glimmer3 score - -
Genemark probabilities .8   .9 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu