LOADING...
   TM0574;TM0574
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0574    TM0574            JCSG 282447 PDB Deposition 04-JUN-28              PDB id: 1vky

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0574
DESCRIPTIONS-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-) (Queuosine biosynthesis protein queA).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: SYNTHESIZES OQ FROM PREQ1 IN A SINGLE S-
ADENOSYLMETHIONINE-REQUIRING STEP. THE RIBOSYL MOIETY OF ADOMET IS
TRANSFERRED AND ISOMERIZED TO THE EPOXYCYCLOPENTANE RESIDUE OF OQ
(BY SIMILARITY).
-!- PATHWAY: QUEUOSINE BIOSYNTHESIS.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (POTENTIAL).
-!- SIMILARITY: BELONGS TO THE QUEA FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; QUEA_THEMA
DR SPTR; Q9WZ44 (flat text); Q9WZ44 (good view)
DR GenBank; AAD35659
DR Pfam; PF02547; Queuosine_synth;
DR Interpro; IPR003699; Queuosine_synth;
DR PDB; 1VKY; Identical; 17-AUG-04; S-ADENOSYLMETHIONINE:TRNA RIBOSYLTRANSFERASE- ISOMERASE;
DR PDB; 1YY3; Highly similar; 21-MAR-06; S-ADENOSYLMETHIONINE:TRNA RIBOSYLTRANSFERASE- ISOMERASE;
DR PDB; 1WDI; Highly similar; 17-NOV-04; HYPOTHETICAL PROTEIN TT0907;
DR KEGG; 5.; Enzyme page
DR FFAS; 282447; Fold and function assignment.
DR TVPC; TM0574; Homologs in PDB, JCSG and SG center.
DR OVP; TM0574; Ortholog view popup.
DR TPM; TM0574; Target PDB monitor.
DR FSS; TM0574; Target function coverage.
PROPERTY Residues: 335 aa
Molecule Weight: 38660.09 Dalton
Isoelectric Point: 8.61
Extinction Coefficient: 21890
Gravy Index: -.28
Number of Met residues: 6
Percentage of Met residues: 1.79 %
Number of Cys residues: 2
Percentage of Cys residues: 0.60 %
SEQUENCE  amino acids 335 aa
>TM0574  TM0574 S-adenosylmethionine tRNA ribosyltransferase (queA)
MKVSEFDYELPPELIAQEPVEPRDASRLMVLHRKTQRIEHRIFREIIEYLEPGDLLVLNV
SKVIPARLYARKKTGASIEILLIERLEEGIWKCLVRPGQKVKKGTELVIDEDLSAVCLGR
GEDGTRILKFQPQDDRLIFEKGRTPLPPYIKNEVPLERYQTVYAKEEGSVAAPTAGLHFT
PELIEKLKKKGVQFAEVVLHVGIGTFRPVKVEEVEKHKMHEEFYQVPKETVRKLRETRER
GNRIVAVGTTTVRTLETIARLPEQEEYVGKTDLFIYPPFEFKLVDALVTNFHLPRSTLLM
LVAAFAGKDFVMEAYREAVKRRYRFFSFGDAMLIL

CDS  cDNA 1005 bp
   1 atgaaggtat cggaattcga ttatgaactt ccaccagaac tcatagcgca ggaacctgtg    60
  61 gaaccacggg acgcttcccg actcatggtg ctccacagaa agacgcagag aatagaacac   120
 121 cgtatattcc gggagataat agagtatctt gaacccggcg atctgctcgt tctgaacgta   180
 181 tcgaaggtga taccagcccg tctctacgcg aggaaaaaaa cgggtgccag catcgaaatt   240
 241 cttctgatag agcgtttgga ggaaggtatc tggaagtgcc ttgtgagacc gggtcagaag   300
 301 gtgaaaaaag gaacggaact tgtaatcgat gaggatctgt ctgccgtctg cctcggtcgg   360
 361 ggtgaagatg gaacgaggat tctgaagttt cagcctcagg acgatagatt gatcttcgag   420
 421 aagggcagga cacctcttcc gccgtacata aaaaacgaag ttcctctcga gaggtatcaa   480
 481 accgtgtacg cgaaagaaga aggctccgtc gctgcgccga ccgcggggct tcatttcaca   540
 541 ccagaactca tagagaagtt gaagaaaaaa ggggttcaat tcgccgaagt cgttttgcac   600
 601 gtgggaatag ggactttcag gcccgtgaag gttgaggaag tggaaaaaca caagatgcac   660
 661 gaggaattct accaggttcc aaaagagacg gtcagaaaac tcagagagac aagggaaagg   720
 721 ggaaacagaa ttgtagcggt tgggacaaca acggtgagaa ccttggagac aatcgccaga   780
 781 cttcctgagc aggaagaata cgtgggaaaa accgatctat tcatatatcc acccttcgag   840
 841 ttcaaactcg tcgatgccct ggttaccaac tttcaccttc ctcgttccac tcttctcatg   900
 901 ctggttgcgg cgttcgcggg gaaggatttc gtcatggaag cctacaggga agccgtgaaa   960
 961 agaagataca gattcttctc tttcggcgat gcgatgctga ttctg  1005
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
604349 605356 2 Glimmer3 score 10.38 poor
Genemark probabilities .95   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu