LOADING...
   TM0570;TM0570
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0570    TM0570            JCSG 282443 PDB Deposition 04-SEP-15              PDB id: 1vma

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0570
DESCRIPTIONCell division protein ftsY.
ORGANISMThermotoga maritima
COMMENTBelongs to Subsystem: Bacterial Cell Division.
Functional coupling with:
Cell division protein ftsA - TM0835
Cell division protein ftsZ - TM0836
General secretion pathway protein E - TM0837
Rod shape-determining protein rodA - TM0839
DR UNIPROT; Q9WZ40_THEMA
DR SPTR; Q9WZ40 (flat text); Q9WZ40 (good view)
DR GenBank; AAD35655
DR Pfam; PF00448; SRP54;
DR Pfam; PF02881; SRP54_N;
DR Interpro; IPR003593; AAA_ATPase;
DR Interpro; IPR004390; ABC_transpt_FtsY;
DR Interpro; IPR000897; SRP54;
DR PDB; 1VMA; Identical; 28-SEP-04; CELL DIVISION PROTEIN FTSY;
DR PDB; 5GAD; Highly similar; 27-JAN-16; ESRP 4.5S RNA;
DR PDB; 2YHS; Highly similar; 18-MAY-11; CELL DIVISION PROTEIN FTSY;
DR PDB; 2QY9; Highly similar; 02-OCT-07; CELL DIVISION PROTEIN FTSY;
DR PDB; 2XXA; Highly similar; 02-MAR-11; SIGNAL RECOGNITION PARTICLE PROTEIN;
DR PDB; 1FTS; Highly similar; 20-MAY-98; FTSY;
DR PDB; 3ZN8; Highly similar; 06-MAR-13; SIGNAL RECOGNITION PARTICLE PROTEIN;
DR PDB; 4C7O; Highly similar; 20-NOV-13; SIGNAL RECOGNITION PARTICLE PROTEIN;
DR FFAS; 282443; Fold and function assignment.
DR TVPC; TM0570; Homologs in PDB, JCSG and SG center.
DR OVP; TM0570; Ortholog view popup.
DR TPM; TM0570; Target PDB monitor.
DR FSS; TM0570; Target function coverage.
PROPERTY Residues: 294 aa
Molecule Weight: 32044.51 Dalton
Isoelectric Point: 5.48
Extinction Coefficient: 6990
Gravy Index: 0
Number of Met residues: 4
Percentage of Met residues: 1.36 %
Number of Cys residues: 1
Percentage of Cys residues: 0.34 %
SEQUENCE  amino acids 294 aa
>TM0570  TM0570 cell division protein FtsY (ftsY)
MGLFDFLKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYILERL
EEKDGDALESLKEIILEILNFDTKLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEG
KSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVAFDAVAHALARNKDVVII
DTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVT
GIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE

CDS  cDNA 882 bp
   1 atgggactct tcgatttttt gaaaaaggga ctccagaaga cgaaagaaac gttttttgga    60
  61 cgagtggtga agctcctcaa aggaaaaaag ctggacgatg aaacccgcga ggagctggaa   120
 121 gaacttctca ttcaagcgga cgtgggagtc gagacaacgg aatacattct ggagagattg   180
 181 gaagagaagg acggagacgc tctcgagtct ctcaaggaaa tcattctgga aattctgaac   240
 241 ttcgatacga agctgaacgt tcctcctgaa cccccgttcg tgatcatggt tgttggtgtc   300
 301 aacggaacgg gaaagaccac ctcctgtgga aagctcgcaa agatgttcgt ggatgaagga   360
 361 aagagtgtgg tgctcgctgc ggcggatact ttcagagcag ccgccataga acagctgaag   420
 421 atatggggag aacgtgtcgg tgccacggtg atatcccact cggaaggagc agatccggcc   480
 481 gccgttgcct ttgacgcggt ggctcacgct ctcgccagaa acaaagatgt ggtcataata   540
 541 gacaccgccg gaagacttca cacgaagaag aatctcatgg aggaattgcg gaaggttcac   600
 601 agagttgtca agaagaagat ccccgacgct ccgcacgaaa cgctcctcgt gatagacgcc   660
 661 accaccggcc aaaacggact tgttcaggca aaaatattca aagaagcagt gaatgtcacc   720
 721 ggtataattc tcacaaagct cgacggaacc gcgaaaggcg gaataactct ggccattgcc   780
 781 cgggaactgg gaattcccat aaagttcatc ggtgtcggag aaaaggcaga agacctgagg   840
 841 cctttcgatc ctgaggcctt tgtggaggta ttgctttcag aa   882
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
599293 600177 -1 Glimmer3 score 15.88 good
Genemark probabilities .94   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu