LOADING...
   TM0561;TM0561
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0561    TM0561            JCSG 282434 PDB Deposition 06-JUN-01              PDB id: 2iub

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0561
DESCRIPTIONMagnesium Mg(2+)/cobalt Co(2+) transport protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; CORA_THEMA
DR SPTR; Q9WZ31 (flat text); Q9WZ31 (good view)
DR GenBank; AAD35646
DR Pfam; PF01544; CorA;
DR Interpro; IPR004488; CorA_transp;
DR Interpro; IPR002523; Mg2+_transptCorA;
DR PDB; 4I0U; Identical; 06-MAR-13; MAGNESIUM TRANSPORT PROTEIN CORA;
DR PDB; 3JCF; Identical; 17-FEB-16; MAGNESIUM TRANSPORT PROTEIN CORA;
DR PDB; 3JCG; Identical; 17-FEB-16; MAGNESIUM TRANSPORT PROTEIN CORA;
DR PDB; 3JCH; Identical; 17-FEB-16; MAGNESIUM TRANSPORT PROTEIN CORA;
DR PDB; 2BBJ; Identical; 13-DEC-05; DIVALENT CATION TRANSPORT-RELATED PROTEIN;
DR PDB; 2HN2; Identical; 29-AUG-06; MAGNESIUM TRANSPORT PROTEIN CORA;
DR PDB; 2IUB; Identical; 03-AUG-06; DIVALENT CATION TRANSPORT-RELATED PROTEIN;
DR PDB; 2BBH; Identical; 13-DEC-05; DIVALENT CATION TRANSPORT-RELATED PROTEIN;
DR FFAS; 282434; Fold and function assignment.
DR TVPC; TM0561; Homologs in PDB, JCSG and SG center.
DR OVP; TM0561; Ortholog view popup.
DR TPM; TM0561; Target PDB monitor.
DR FSS; TM0561; Target function coverage.
PROPERTY Residues: 351 aa
Molecule Weight: 41444.14 Dalton
Isoelectric Point: 5.41
Extinction Coefficient: 52830
Gravy Index: -.1
Number of Met residues: 10
Percentage of Met residues: 2.85 %
Number of Cys residues: 1
Percentage of Cys residues: 0.28 %
SEQUENCE  amino acids 351 aa
>TM0561  TM0561 divalent cation transport-related protein
MEEKRLSAKKGLPPGTLVYTGKYREDFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPT
WINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLH
ELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDD
YFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELRKTIWPLREVLSSLYRDVP
PLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATI
FMPLTFIAGIYGMNFEYMPELRWKWGYPVVLAVMGVIAVIMVVYFKKKKWL

CDS  cDNA 1053 bp
   1 gtggaggaaa agaggctgtc tgctaagaaa ggtctccccc caggaacgct cgtttacaca    60
  61 gggaagtaca gggaagattt tgagattgaa gtgatgaatt actccataga ggaatttcgc   120
 121 gagttcaaaa ccacagatgt cgaatccgtt cttcccttca gagattcttc aacacccacc   180
 181 tggataaaca taacaggcat acacaggacg gatgtggttc aaagggtagg tgagttcttt   240
 241 ggtattcatc ctctcgtgct cgaagacatc ctcaatgtgc atcagagacc aaaagtggag   300
 301 tttttcgaaa actacgtgtt catcgttctg aagatgttca cctatgataa aaatcttcat   360
 361 gaactggaat cggagcaggt cagtttgata ctcacaaaaa actgcgttct tatgtttcag   420
 421 gaaaagatag gggacgtgtt cgatcccgta cgggaaagaa tcagatacaa caggggaatc   480
 481 ataaggaaaa agagagcgga ttacctcctc tactcactga tagatgcact ggtggatgac   540
 541 tatttcgtcc tgctggagaa gatcgacgat gagatcgatg tactggagga agaagtgctc   600
 601 gaaagacctg aaaaagagac agttcagagg acacatcaac tcaagagaaa tctggttgaa   660
 661 ctgagaaaga cgatctggcc gttgagagaa gtgttgagtt ctctttacag agatgttcct   720
 721 cctcttatag aaaaagaaac ggtcccatat ttcagagatg tatacgatca cactatccag   780
 781 attgcagaca ccgtagaaac cttcagagac atcgtgagcg gtcttcttga tgtgtatctt   840
 841 tcgagtgtaa gtaacaaaac aaacgaagtg atgaaggtgc tcaccatcat agcgacgatc   900
 901 ttcatgcctc tcaccttcat agcgggtatc tacggaatga acttcgaata catgccggag   960
 961 ctcagatgga aatggggcta tcctgtggtt ctcgctgtta tgggtgtgat cgctgtcatc  1020
1021 atggtggtct acttcaagaa aaagaagtgg ctg  1053
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
591673 592728 1 Glimmer3 score 13.91 good
Genemark probabilities .93   .45 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu