LOADING...
   TM0559;TM0559
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0559    TM0559            JCSG 282432 PDB Deposition 05-AUG-11              PDB id: 2anu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0559
DESCRIPTIONPredicted metal-dependent phosphoesterase (PHP family)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZ29_THEMA
DR SPTR; Q9WZ29 (flat text); Q9WZ29 (good view)
DR GenBank; AAD35644
DR Pfam; PF02811; PHP;
DR Interpro; IPR004013; PHP_C;
DR Interpro; IPR003141; Pesterase_PHP_N;
DR Interpro; IPR006025; Pept_M_Zn_BS;
DR PDB; 2ANU; Identical; 18-OCT-05; HYPOTHETICAL PROTEIN TM0559;
DR FFAS; 282432; Fold and function assignment.
DR TVPC; TM0559; Homologs in PDB, JCSG and SG center.
DR OVP; TM0559; Ortholog view popup.
DR TPM; TM0559; Target PDB monitor.
DR FSS; TM0559; Target function coverage.
PROPERTY Residues: 243 aa
Molecule Weight: 28611.07 Dalton
Isoelectric Point: 5.61
Extinction Coefficient: 57410
Gravy Index: -.56
Number of Met residues: 5
Percentage of Met residues: 2.06 %
Number of Cys residues: 1
Percentage of Cys residues: 0.41 %
SEQUENCE  amino acids 243 aa
>TM0559  TM0559 conserved hypothetical protein
MKTDTEWLLCDFHVHTNMSDGHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGE
PLGAITEDKFQDYLKRLWREQKRAWEEYGMILIPGVEITNNTDLYHIVAVDVKEYVDPSL
PVEEIVEKLKEQNALVIAAHPDRKKQDEEHLSWYLWANMERFKDTFDAWEIANRDDLFNS
VGVKKYRYVANSDFHELWHVYSWKTLVKSEKNIEAIKEAIRKNTDVAIYLMRKNRLSSLS
DVI

CDS  cDNA 729 bp
   1 atgaaaaccg atacggaatg gcttctttgt gatttccatg tacacacgaa catgagtgac    60
  61 gggcatcttc ctctgggaga agtggtggat ctgtttggaa aacatggagt ggacgtggtt   120
 121 tccataacag atcatatagt cgaccgaaga actctcgagc agagaaagag gaacggagaa   180
 181 ccgctcggag cgatcacaga agataagttt caggattatt tgaaacgtct ctggagagaa   240
 241 cagaaaaggg cctgggaaga atatggaatg atcctcatac cgggtgttga gatcacgaac   300
 301 aacacggatc tgtaccacat agtcgccgtg gatgtgaagg agtacgtaga tccttcactg   360
 361 cctgtagaag aaattgtgga gaagttgaag gagcaaaacg ctcttgttat agccgcgcat   420
 421 ccggatagaa aaaagcaaga tgaagaacat ctttcgtggt atctctgggc gaacatggag   480
 481 cgtttcaagg acacgttcga cgcgtgggaa atcgcgaatc gtgatgacct gttcaactct   540
 541 gttggtgtga aaaagtatcg atacgtggcg aactccgatt ttcacgaact ttggcacgtt   600
 601 tactcctgga aaacccttgt gaagtcggag aaaaacatcg aggcgataaa ggaagcaatc   660
 661 agaaagaaca cggatgtggc gatctatttg atgagaaaaa acaggttgag ttctctgtca   720
 721 gatgtgata   729
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
590214 590945 3 Glimmer3 score 12.75 good
Genemark probabilities .85   .16 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu