LOADING...
   TM0556;TM0556
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0556    TM0556            JCSG 282429 PDB Deposition 04-JUL-20              PDB id: 1vlc

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0556
DESCRIPTION3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM dehydrogenase) (IMDH) (3-IPM-DH).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CATALYZES THE OXIDATION OF 3-CARBOXY-2-HYDROXY-4-
METHYLPENTANOATE (3-ISOPROPYLMALATE) TO 3-CARBOXY-4-METHYL-2-
OXOPENTANOATE. THE PRODUCT DECARBOXYLATES TO 4-METHYL-2
OXOPENTANOATE.
-!- CATALYTIC ACTIVITY: 3-CARBOXY-2-HYDROXY-4-METHYLPENTANOATE +
NAD(+) = 3-CARBOXY-4-METHYL-2-OXOPENTANOATE + NADH.
-!- PATHWAY: LEUCINE BIOSYNTHESIS; THIRD STEP.
-!- SUBUNIT: HOMODIMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC.
-!- SIMILARITY: BELONGS TO THE ISOCITRATE AND ISOPROPYLMALATE
DEHYDROGENASES FAMILY. LEUB SUBFAMILY 1.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; LEU3_THEMA
DR SPTR; Q9WZ26 (flat text); Q9WZ26 (good view)
DR GenBank; AAD35641
DR Pfam; PF00180; Iso_dh;
DR Interpro; IPR001804; Isodh;
DR Interpro; IPR004429; LeuB;
DR PDB; 1VLC; Identical; 21-SEP-04; 3-ISOPROPYLMALATE DEHYDROGENASE;
DR PDB; 3U1H; Highly similar; 02-NOV-11; 3-ISOPROPYLMALATE DEHYDROGENASE;
DR PDB; 1CM7; Highly similar; 01-JUL-99; PROTEIN (3-ISOPROPYLMALATE DEHYDROGENASE);
DR PDB; 1CNZ; Highly similar; 01-JUN-99; PROTEIN (3-ISOPROPYLMALATE DEHYDROGENASE);
DR PDB; 3VKZ; Highly similar; 29-FEB-12; 3-ISOPROPYLMALATE DEHYDROGENASE;
DR PDB; 3VL2; Highly similar; 29-FEB-12; 3-ISOPROPYLMALATE DEHYDROGENASE;
DR PDB; 3VL3; Highly similar; 29-FEB-12; 3-ISOPROPYLMALATE DEHYDROGENASE;
DR PDB; 3VL4; Highly similar; 29-FEB-12; 3-ISOPROPYLMALATE DEHYDROGENASE;
DR KEGG; 1.1.1.85; Enzyme page
DR FFAS; 282429; Fold and function assignment.
DR TVPC; TM0556; Homologs in PDB, JCSG and SG center.
DR OVP; TM0556; Ortholog view popup.
DR TPM; TM0556; Target PDB monitor.
DR FSS; TM0556; Target function coverage.
PROPERTY Residues: 354 aa
Molecule Weight: 39188.19 Dalton
Isoelectric Point: 5.44
Extinction Coefficient: 32890
Gravy Index: -.16
Number of Met residues: 10
Percentage of Met residues: 2.82 %
Number of Cys residues: 2
Percentage of Cys residues: 0.56 %
SEQUENCE  amino acids 354 aa
>TM0556  TM0556 3-isopropylmalate dehydrogenase (leuB)
MKIAVLPGDGIGPEVVREALKVLEVVEKKTGKTFEKVFGHIGGDAIDRFGEPLPEETKKI
CLEADAIFLGSVGGPKWDDLPPEKRPEIGGLLALRKMLNLYANIRPIKVYRSLVHVSPLK
EKVIGSGVDLVTVRELSYGVYYGQPRGLDEEKGFDTMIYDRKTVERIARTAFEIAKNRRK
KVTSVDKANVLYSSMLWRKVVNEVAREYPDVELTHIYVDNAAMQLILKPSQFDVILTTNM
FGDILSDESAALPGSLGLLPSASFGDKNLYEPAGGSAPDIAGKNIANPIAQILSLAMMLE
HSFGMVEEARKIERAVELVIEEGYRTRDIAEDPEKAVSTSQMGDLICKKLEEIW

CDS  cDNA 1062 bp
   1 atgaagatag cggttttacc tggagacggt ataggtcctg aagttgtaag ggaagctctg    60
  61 aaagtgctcg aggtggtgga aaagaaaacg gggaaaacct ttgagaaagt ctttggacac   120
 121 atcggagggg atgccataga cagattcggt gaaccccttc ctgaggagac aaaaaagata   180
 181 tgtctggaag ccgacgcgat cttccttgga agcgtcggag gacctaaatg ggacgatctt   240
 241 cctccggaga agaggccgga aatagggggg cttcttgccc taaggaagat gctcaacctt   300
 301 tacgcaaaca tcaggcctat aaaggtctac agatcgcttg tgcatgtctc tcctctgaaa   360
 361 gaaaaggtga ttggatccgg ggtcgatctt gtgaccgtca gggaactttc ctacggagtt   420
 421 tactacggcc agccgagggg attggatgaa gaaaagggat tcgacaccat gatctacgac   480
 481 agaaaaaccg tggaacggat cgcgagaact gcctttgaaa tcgcaaaaaa cagaagaaaa   540
 541 aaggtcacct ccgtcgacaa agcgaacgtc ctctacagtt ctatgctgtg gaggaaagtt   600
 601 gtgaacgaag tagcgagaga ataccctgat gtggagctga cgcacatata tgtggacaac   660
 661 gctgctatgc agctcatcct gaaaccatcg cagttcgatg tgatcctcac aacgaacatg   720
 721 tttggagaca ttctctcgga tgagagcgcg gcacttcctg gttctcttgg tcttctgccg   780
 781 tccgcgtctt tcggtgataa gaacctctac gaaccggcag gaggttccgc tcctgatata   840
 841 gccggaaaga acatcgccaa cccgatcgca cagatcctct ctctcgccat gatgctcgag   900
 901 cattcctttg gaatggtgga agaggcaaga aagatagaaa gagcggttga gctggtgata   960
 961 gaagagggat acagaaccag agacatcgca gaggatccag aaaaggcggt ttcgacctct  1020
1021 cagatgggag atctcatatg taaaaaactc gaagaaatat gg  1062
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
584443 585507 1 Glimmer3 score 14.95 good
Genemark probabilities .98   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu