LOADING...
   TM0544;TM0544
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0544    TM0544            JCSG 282417 PDB Deposition 04-NOV-10              PDB id: 1vpl

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0544
DESCRIPTIONABC transporter ATP-binding protein.
ORGANISMThermotoga maritima
COMMENTBy homology. Co-clustered with Threonine biosynthesis.
As well as the previous gene: TM0543 (another ABC component)
Possibly implicate them in Aspartate uptake (for Thr biosynthesis)
DR UNIPROT; Q9WZ14_THEMA
DR SPTR; Q9WZ14 (flat text); Q9WZ14 (good view)
DR GenBank; AAD35629
DR Pfam; PF00005; ABC_tran;
DR Interpro; IPR003593; AAA_ATPase;
DR Interpro; IPR003439; ABC_transporter;
DR PDB; 1VPL; Identical; 23-NOV-04; ABC TRANSPORTER, ATP-BINDING PROTEIN;
DR PDB; 4YER; Highly similar; 11-MAR-15; ABC TRANSPORTER ATP-BINDING PROTEIN;
DR FFAS; 282417; Fold and function assignment.
DR TVPC; TM0544; Homologs in PDB, JCSG and SG center.
DR OVP; TM0544; Ortholog view popup.
DR TPM; TM0544; Target PDB monitor.
DR FSS; TM0544; Target function coverage.
PROPERTY Residues: 244 aa
Molecule Weight: 27128 Dalton
Isoelectric Point: 5.83
Extinction Coefficient: 8940
Gravy Index: -.07
Number of Met residues: 6
Percentage of Met residues: 2.46 %
Number of Cys residues: 2
Percentage of Cys residues: 0.82 %
SEQUENCE  amino acids 244 aa
>TM0544  TM0544 ABC transporter, ATP-binding protein
MGAVVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIV
TVFGKNVVEEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATE
IAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQA
SQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQNIEEVFEEVVKC
SENF

CDS  cDNA 732 bp
   1 atgggggcag tggttgtaaa ggatctgaga aaaagaattg gaaagaaaga gatcctgaag    60
  61 ggaatttctt ttgagatcga agaaggagag atctttggtc tcataggacc gaacggtgcg   120
 121 ggaaagacca ccacactcag gatcatctcc acgctgatca agccttcctc cggaatcgtc   180
 181 accgtatttg gaaagaacgt tgttgaagaa ccacacgaag tgagaaagct gatcagctac   240
 241 cttcccgaag aagcgggcgc ctacaggaac atgcagggaa tcgaatacct gagattcgtt   300
 301 gcgggtttct acgcttccag ctcaagcgag atagaagaga tggtcgaacg ggcaacggag   360
 361 atcgccggtc tcggtgaaaa gataaaagac agagtctcaa cctacagcaa aggtatggtg   420
 421 agaaaactcc tcatagcgag ggctttgatg gtgaatcctc gtctcgccat cctcgacgaa   480
 481 cccacctccg gcctcgatgt cctcaacgca agagaagtga gaaagatatt gaaacaggca   540
 541 tctcaggaag gtctcaccat actggtctct tctcacaaca tgctcgaagt ggaattcctc   600
 601 tgtgatcgaa tagcgctgat tcacaacgga acgattgtgg aaacgggaac cgttgaagaa   660
 661 ctcaaggaaa ggtacaaagc acagaacatc gaagaggtct tcgaggaggt ggtgaaatgt   720
 721 tcggaaaact tc   732
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
569576 570310 -2 Glimmer3 score 18.91 good
Genemark probabilities .92   .94 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu