LOADING...
   TM0542;TM0542
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0542    TM0542            JCSG 282415 PDB Deposition 04-JUL-13              PDB id: 1vl6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0542
DESCRIPTIONNAD-dependent malic enzyme (EC 1.1.1.38)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZ12_THEMA
DR SPTR; Q9WZ12 (flat text); Q9WZ12 (good view)
DR GenBank; AAD35627
DR Pfam; PF03949; Malic_M;
DR Pfam; PF00390; malic;
DR Interpro; IPR001891; Malic_oxred;
DR Interpro; IPR000205; NAD_BS;
DR Interpro; IPR000594; ThiF_domain;
DR PDB; 1VL6; Identical; 17-AUG-04; MALATE OXIDOREDUCTASE;
DR PDB; 2HAE; Identical; 04-JUL-06; MALATE OXIDOREDUCTASE;
DR PDB; 1WW8; Highly similar; 21-MAR-06; MALATE OXIDOREDUCTASE;
DR PDB; 2DVM; Highly similar; 02-OCT-07; 439AA LONG HYPOTHETICAL MALATE OXIDOREDUCTASE;
DR PDB; 3NV9; Highly similar; 20-JUL-11; MALIC ENZYME;
DR KEGG; 1.1.1.38; Enzyme page
DR FFAS; 282415; Fold and function assignment.
DR TVPC; TM0542; Homologs in PDB, JCSG and SG center.
DR OVP; TM0542; Ortholog view popup.
DR TPM; TM0542; Target PDB monitor.
DR FSS; TM0542; Target function coverage.
PROPERTY Residues: 376 aa
Molecule Weight: 41041.13 Dalton
Isoelectric Point: 5.32
Extinction Coefficient: 21430
Gravy Index: .02
Number of Met residues: 7
Percentage of Met residues: 1.86 %
Number of Cys residues: 5
Percentage of Cys residues: 1.33 %
SEQUENCE  amino acids 376 aa
>TM0542  TM0542 malate oxidoreductase
MDALEIHRFLKGKIRTALPVEKVDRETLSLLYTPGVADVARACAEDPEKTYVYTSRWNTV
AVVSDGSAVLGLGNIGPYGALPVMEGKAFLFKAFADIDAFPICLSESEEEKIISIVKSLE
PSFGGINLEDIGAPKCFRILQRLSEEMNIPVFHDDQQGTAVVVSAAFLNALKLTEKKIEE
VKVVVNGIGAAGYNIVKFLLDLGVKNVVAVDRKGILNENDPETCLNEYHLEIARITNPER
LSGDLETALEGADFFIGVSRGNILKPEWIKKMSRKPVIFALANPVPEIDPELAREAGAFI
VATGRSDHPNQVNNLLAFPGIMKGAVEKRSKITKNMLLSAVEAIARSCEPEPERIIPEAF
DMKVHLNVYTAVKGSA

CDS  cDNA 1128 bp
   1 gtggatgcgc tcgagataca cagatttctg aagggaaaga taagaactgc ccttcctgtt    60
  61 gaaaaggttg acagggagac gctatctctg ctctacacac ccggtgtcgc agatgttgcc   120
 121 agagcctgtg ctgaggatcc agaaaagacc tacgtttaca cctcaagatg gaacacggtt   180
 181 gccgttgttt cagacggaag cgctgttctg ggactcggta acatagggcc ttacggtgct   240
 241 cttccagtga tggaggggaa agcctttctt ttcaaggcct tcgccgatat cgacgccttt   300
 301 cccatctgtc tttccgaatc cgaggaggaa aaaataatct ccattgtgaa gagtttagag   360
 361 ccgagctttg gcggcataaa ccttgaggac ataggagcgc cgaagtgttt tcgaatcctt   420
 421 cagcgcctct cggaagagat gaacattcct gttttccacg acgaccagca gggaaccgcc   480
 481 gttgtggtgt ccgcagcttt tctcaacgcg ctgaaactca cggagaaaaa gatcgaagaa   540
 541 gtaaaggtgg ttgtgaacgg tataggagct gctggctaca acatcgtgaa gtttctgctc   600
 601 gatcttggtg tgaaaaacgt tgtagctgtc gacagaaaag gcatcctcaa cgaaaacgat   660
 661 ccggagacct gtttgaacga gtaccacctc gaaatcgcac gcatcaccaa tccggaaagg   720
 721 ctatccggtg atcttgaaac agccctggaa ggtgctgatt tcttcatagg tgtttcgagg   780
 781 ggaaacattc tgaaaccaga gtggataaag aagatgagca gaaaacctgt gatattcgcc   840
 841 ctcgcgaatc ctgttcccga gatagatcca gaactcgcaa gggaagcggg tgccttcata   900
 901 gttgcaacgg gaagatcaga tcatccaaat caggtgaaca accttctcgc tttccccggc   960
 961 attatgaaag gagccgtgga gaaaagatcg aagatcacga agaacatgct tctctccgcc  1020
1021 gtggaagcca tcgctcgctc gtgtgaacca gaaccagagc gcatcatacc ggaggctttc  1080
1081 gacatgaagg ttcatttgaa cgtctatact gctgtcaaag gttcagcg  1128
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
567234 568364 3 Glimmer3 score 14.18 good
Genemark probabilities .94   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu