LOADING...
   TM0511;TM0511
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0511    TM0511            JCSG 359753 PDB Deposition 04-APR-16              PDB id: 1vk2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0511
DESCRIPTIONUracil-DNA glycosylase (EC 3.2.2.-)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYY1_THEMA
DR SPTR; Q9WYY1 (flat text); Q9WYY1 (good view)
DR GenBank; AAD35596
DR Pfam; PF03167; UDG;
DR Interpro; IPR005273; SPO1polNrel;
DR Interpro; IPR005122; UDNA_glycsylseSF;
DR PDB; 1L9G; Identical; 27-MAY-03; CONSERVED HYPOTHETICAL PROTEIN;
DR PDB; 1VK2; Identical; 04-MAY-04; URACIL-DNA GLYCOSYLASE TM0511;
DR PDB; 1UI0; Highly similar; 14-OCT-03; URACIL-DNA GLYCOSYLASE;
DR PDB; 1UI1; Highly similar; 14-OCT-03; URACIL-DNA GLYCOSYLASE;
DR PDB; 2D3Y; Highly similar; 17-OCT-06; URACIL-DNA GLYCOSYLASE;
DR PDB; 2DDG; Highly similar; 13-FEB-07; 5'-D(*AP*TP*GP*TP*TP*GP*CP*(D1P)P*TP*TP*AP*GP*TP* CHAIN: C;
DR PDB; 2DEM; Highly similar; 24-APR-07; 5'-D(*AP*TP*GP*TP*TP*GP*CP*(D1P)P*TP*TP*AP*GP*TP* CHAIN: C;
DR PDB; 2DP6; Highly similar; 22-MAY-07; 5'-D(*AP*TP*GP*TP*TP*GP*CP*(D1P)P*TP*TP*AP*GP*TP* CHAIN: C;
DR KEGG; 3.2.2.-; Enzyme page
DR FFAS; 282384; Fold and function assignment.
DR TVPC; TM0511; Homologs in PDB, JCSG and SG center.
DR OVP; TM0511; Ortholog view popup.
DR TPM; TM0511; Target PDB monitor.
DR FSS; TM0511; Target function coverage.
PROPERTY Residues: 192 aa
Molecule Weight: 21499.79 Dalton
Isoelectric Point: 8.6
Extinction Coefficient: 9970
Gravy Index: -.27
Number of Met residues: 3
Percentage of Met residues: 1.56 %
Number of Cys residues: 5
Percentage of Cys residues: 2.60 %
SEQUENCE  amino acids 192 aa
>TM0511  TM0511 conserved hypothetical protein
MYTREELMEIVSERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFV
GRAGMLLTELLRESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDV
IVALGATALSFFVDGKKVSITKVRGNPIDWLGGKKVIPTFHPSYLLRNRSNELRRIVLED
IEKAKSFIKKEG

CDS  cDNA 576 bp
   1 ttgtatacaa gggaagaact catggagata gtgtcagaaa gagtgaaaaa gtgtacggct    60
  61 tgcccacttc atctgaatag gacaaacgtt gtcgtaggag aaggaaatct ggatacgagg   120
 121 attgtctttg tgggagaagg accgggagag gaagaagaca agacgggaag acctttcgtc   180
 181 ggcagagcgg gaatgcttct gacggaactg ctcagagaat caggtatcag aagagaagat   240
 241 gtttacatat gcaacgttgt gaaatgcagg cctcccaaca acagaacacc cactcctgaa   300
 301 gaacaggcgg catgtggaca ttttttactc gctcagatcg aaatcatcaa cccagatgtg   360
 361 atagttgctc tcggagccac ggcgctgtct ttcttcgtgg atgggaaaaa ggtatccata   420
 421 actaaggtca gaggaaatcc catcgactgg ctcggaggaa aaaaggtcat tccaacattc   480
 481 catccgagtt atctcctgag aaatagaagt aatgaactca gaaggatcgt tcttgaggat   540
 541 attgagaaag caaaaagttt cataaagaag gagggt   576
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
537550 538128 -1 Glimmer3 score 8.48 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu