LOADING...
   TM0492;TM0492
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0492    TM0492            JCSG 282365 PDB Deposition 06-FEB-17              PDB id: 2g36

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0492
DESCRIPTIONTryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tryptophan--tRNA ligase) (TrpRS).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: ATP + L-TRYPTOPHAN + TRNA(TRP) = AMP +
DIPHOSPHATE + L-TRYPTOPHANYL-TRNA(TRP).
-!- SUBUNIT: HOMODIMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC.
-!- SIMILARITY: BELONGS TO CLASS-I AMINOACYL-TRNA SYNTHETASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; SYW_THEMA
DR SPTR; Q9WYW2 (flat text); Q9WYW2 (good view)
DR GenBank; AAD35577
DR Pfam; PF00579; tRNA-synt_1b;
DR Interpro; IPR002305; tRNA-synt_1b;
DR Interpro; IPR001412; tRNA-synt_I;
DR Interpro; IPR002306; Trp_tRNA-synt_1b;
DR PDB; 2G36; Identical; 28-MAR-06; TRYPTOPHANYL-TRNA SYNTHETASE;
DR PDB; 2A4M; Highly similar; 02-AUG-05; TRYPTOPHANYL-TRNA SYNTHETASE II;
DR PDB; 1YI8; Highly similar; 22-FEB-05; TRYPTOPHANYL-TRNA SYNTHETASE;
DR PDB; 1YIA; Highly similar; 22-FEB-05; TRYPTOPHANYL-TRNA SYNTHETASE;
DR PDB; 1YID; Highly similar; 02-AUG-05; TRYPTOPHANYL-TRNA SYNTHETASE;
DR PDB; 2EL7; Highly similar; 18-MAR-08; TRYPTOPHANYL-TRNA SYNTHETASE;
DR PDB; 3M5W; Highly similar; 31-MAR-10; TRYPTOPHANYL-TRNA SYNTHETASE;
DR PDB; 3TZL; Highly similar; 05-OCT-11; TRYPTOPHANYL-TRNA SYNTHETASE;
DR KEGG; 6.1.1.2; Enzyme page
DR FFAS; 282365; Fold and function assignment.
DR TVPC; TM0492; Homologs in PDB, JCSG and SG center.
DR OVP; TM0492; Ortholog view popup.
DR TPM; TM0492; Target PDB monitor.
DR FSS; TM0492; Target function coverage.
PROPERTY Residues: 328 aa
Molecule Weight: 37767.59 Dalton
Isoelectric Point: 5.86
Extinction Coefficient: 52370
Gravy Index: -.35
Number of Met residues: 11
Percentage of Met residues: 3.35 %
Number of Cys residues: 6
Percentage of Cys residues: 1.83 %
SEQUENCE  amino acids 328 aa
>TM0492  TM0492 tryptophanyl-tRNA synthetase (trpS)
MRILSGMRPTGKLHIGHLVGALENWVKLQEEGNECFYFVADWHALTTHYDDVSKLKEYTR
DLVRGFLACGIDPEKSVIFVQSGVKEHAELALLFSMIVSVSRLERVPTYKEIKSELNYKD
LSTAGFLIYPVLQAADILIYKAEGVPVGEDQVYHIELTREIARRFNYLYDEVFPEPEAIL
SRVPKLPGTDGRKMSKSYGNIINLEISEKELEQTILRMMTDPARVRRSDPGNPENCPVWK
YHQAFDISEEESKWVWEGCTTASIGCVDCKKLLLKNMKRKLAPIWENFRKIDEDPHYVDD
VIMEGTKKAREVAAKTMEEVRRAMNLMF

CDS  cDNA 984 bp
   1 ttgagaatac tgagcggcat gagacctacc ggaaaactcc atataggtca tctcgtggga    60
  61 gctctggaaa actgggtgaa gcttcaggaa gaaggaaacg aatgtttcta ctttgtcgcg   120
 121 gattggcacg ctttgaccac ccactacgac gatgtttcga agctcaaaga atacacccgc   180
 181 gacctggtga ggggatttct cgcctgtgga atagatcctg aaaagtccgt gatttttgtt   240
 241 cagtctggtg tcaaagagca cgctgagctt gcactgcttt tcagcatgat cgtttctgtt   300
 301 tcacgtctcg agagggttcc cacttacaaa gagataaaaa gtgagctgaa ctacaaagat   360
 361 ctttccacgg ctggttttct catctatccc gttcttcagg cagccgatat tttgatctac   420
 421 aaagctgaag gagtaccagt cggtgaagat caggtttacc acatagaact cacgagggag   480
 481 atcgccaggc gttttaacta tctctacgat gaagtctttc cagaaccaga agcaattctg   540
 541 tctcgggttc caaagcttcc aggaacggac ggccgaaaga tgagcaaaag ctatgggaac   600
 601 ataataaacc tagaaatctc ggaaaaagaa ctggaacaga cgatactgag gatgatgacc   660
 661 gatccagcga gggtgagaag gagcgaccct ggaaatccgg agaactgccc cgtatggaaa   720
 721 taccaccagg cgttcgacat cagtgaagaa gagagcaaat gggtatggga aggctgtaca   780
 781 acggccagca tcggctgtgt tgattgtaag aagttgctgt tgaagaatat gaaacgaaaa   840
 841 ttggcaccga tctgggagaa cttcagaaaa atagacgaag atccacacta cgtggacgac   900
 901 gttataatgg aagggacgaa gaaggccaga gaagtggctg ctaaaacgat ggaagaagtg   960
 961 agaagggcca tgaacctgat gttc   984
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
521101 522087 1 Glimmer3 score 11.96 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu