LOADING...
   TM0488;TM0488
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0488    TM0488            JCSG 282361 PDB Deposition 04-DEC-02              PDB id: 1vq1

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0488
DESCRIPTIONN5-glutamine methyltransferase, HemK(EC 2.1.1.-)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYV8_THEMA
DR SPTR; Q9WYV8 (flat text); Q9WYV8 (good view)
DR GenBank; AAD35573
DR Interpro; IPR004556; HemK;
DR Interpro; IPR002052; N6_Mtase;
DR Interpro; IPR000051; SAM_bind;
DR PDB; 1SG9; Identical; 17-AUG-04; HEMK PROTEIN;
DR PDB; 1NV8; Identical; 27-MAY-03; HEMK PROTEIN;
DR PDB; 1NV9; Identical; 27-MAY-03; HEMK PROTEIN;
DR PDB; 1VQ1; Identical; 01-FEB-05; N5-GLUTAMINE METHYLTRANSFERASE, HEMK;
DR PDB; 1T43; Highly similar; 29-JUN-04; PROTEIN METHYLTRANSFERASE HEMK;
DR PDB; 2B3T; Highly similar; 24-JAN-06; PROTEIN METHYLTRANSFERASE HEMK;
DR PDB; 4DZR; Highly similar; 14-MAR-12; PROTEIN-(GLUTAMINE-N5) METHYLTRANSFERASE, RELEASE SPECIFIC;
DR KEGG; 2.1.1.-; Enzyme page
DR FFAS; 282361; Fold and function assignment.
DR TVPC; TM0488; Homologs in PDB, JCSG and SG center.
DR OVP; TM0488; Ortholog view popup.
DR TPM; TM0488; Target PDB monitor.
DR FSS; TM0488; Target function coverage.
PROPERTY Residues: 282 aa
Molecule Weight: 31607.68 Dalton
Isoelectric Point: 5.43
Extinction Coefficient: 15930
Gravy Index: -.12
Number of Met residues: 4
Percentage of Met residues: 1.42 %
Number of Cys residues: 1
Percentage of Cys residues: 0.35 %
SEQUENCE  amino acids 282 aa
>TM0488  TM0488 hemK protein (hemK)
MDTRKNVSGAERKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSP
TEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKY
GIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEF
LEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSG
KIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS

CDS  cDNA 846 bp
   1 atggacacca gaaagaatgt ctccggagct gagagaaaaa tttggagtct gataagagac    60
  61 tgctctggaa aactcgaggg agtgaccgaa acttctgttc ttgaggtgtt actcatcgtt   120
 121 tcccgggtgc ttgggatccg caaggaagat ctctttttga aagacctggg agtttctcca   180
 181 actgaggaaa aaaggattct ggaactcgtg gagaaaagag caagtggata tcccctgcac   240
 241 tatatcctcg gtgagaaaga gttcatgggc ctttctttcc tcgtggaaga aggcgttttt   300
 301 gttccaaggc cggagacgga ggaactggtc gaactcgccc tcgagctgat aagaaagtac   360
 361 ggaataaaga cagtcgcaga cataggaaca ggaagcggag ccattggagt gagcgttgcg   420
 421 aagttctccg atgcgatcgt tttcgcgacg gacgtttctt ccaaagccgt tgaaatcgcc   480
 481 agaaaaaacg cggaaagaca cggtgtttcc gacagattct ttgtgagaaa aggtgagttt   540
 541 cttgaaccgt tcaaagaaaa attcgcatcg atcgagatga tcctttcgaa tcctccatac   600
 601 gtgaaatcga gtgctcatct gccaaaagat gttcttttcg agcctccaga ggcacttttt   660
 661 ggaggagagg acggtcttga cttttacaga gaatttttcg gcaggtacga tacgagcgga   720
 721 aagattgtgc tgatggagat aggagaagac caggtggagg agttgaaaaa gatcgtttcc   780
 781 gacactgttt tcctgaagga ttccgccgga aagtaccgtt ttctccttct caaccggcgt   840
 841 tcctct   846
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
518378 519226 2 Glimmer3 score - -
Genemark probabilities .89   .03 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu