LOADING...
   TM0487;TM0487
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0487    TM0487            JCSG 282360 PDB Deposition 04-NOV-17              PDB id: 1uwd, 1wcj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0487
DESCRIPTIONConserved PaaD-like protein of unknown function; possibly involved with Fe-S cluster metabolism.
ORGANISMThermotoga maritima
COMMENT Function of PaaD protein is unknown even in Pseudiminas putida and several other bacteria where it is presumed to be a part of Phenylacetate degradation pathway (based on its localization in PAA operon). There is no indication of this pathway in T.maritima, as evidenced by the absence of other known components, most importantly Phenylacetate-CoA ligase (EC 6.2.1.30), the pathway “signature” enzyme. This aerobic pathway is unlikely to be present in anaerobes. Very broad conservation of PaaD homologs in bacteria and archaea suggests that it may have an important general function unrelated to phenylacetate degradation.
Genome context: there is no characteristic conservation in the genomic neighborhood of TM0487. Close homologs of TM0487(in Brucella.melitensis and Agrobacterium tumefaciens) are a part of the conserved chromosomal cluster which includes proteins related to sulfur metabolism. Those include: Cysteine desulfurase, IscU and IscA (HESB)-like proteins involved in Fe-S cluster biosynthesis, ABC-type transport system related to Fe-S cluster assembly. This context suggests possible involvement of PaaD-like proteins in Fe-S cluster metabolism.
DR UNIPROT; Q9WYV7_THEMA
DR SPTR; Q9WYV7 (flat text); Q9WYV7 (good view)
DR GenBank; AAD35572
DR Pfam; PF01883; DUF59;
DR Interpro; IPR002744; DUF59;
DR PDB; 1UWD; Identical; 14-DEC-04; HYPOTHETICAL PROTEIN TM0487;
DR PDB; 1WCJ; Identical; 14-DEC-04; HYPOTHETICAL PROTEIN TM0487;
DR PDB; 3LNO; Highly similar; 16-FEB-10; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 2CU6; Highly similar; 25-NOV-05; DTDP-4-KETO-L-RHAMNOSE REDUCTASE-RELATED PROTEIN;
DR PDB; 3CQ1; Highly similar; 07-APR-09; PUTATIVE UNCHARACTERIZED PROTEIN TTHB138;
DR PDB; 3CQ2; Highly similar; 07-APR-09; PUTATIVE UNCHARACTERIZED PROTEIN TTHB138;
DR PDB; 3CQ3; Highly similar; 07-APR-09; PUTATIVE UNCHARACTERIZED PROTEIN TTHB138;
DR FFAS; 282360; Fold and function assignment.
DR TVPC; TM0487; Homologs in PDB, JCSG and SG center.
DR OVP; TM0487; Ortholog view popup.
DR TPM; TM0487; Target PDB monitor.
DR FSS; TM0487; Target function coverage.
PROPERTY Residues: 104 aa
Molecule Weight: 11637.98 Dalton
Isoelectric Point: 4.39
Extinction Coefficient: 6990
Gravy Index: -.05
Number of Met residues: 7
Percentage of Met residues: 6.73 %
Number of Cys residues: 1
Percentage of Cys residues: 0.96 %
SEQUENCE  amino acids 104 aa
>TM0487  TM0487 conserved hypothetical protein
MPMSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAG
MILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV

CDS  cDNA 312 bp
   1 atgccgatgt cgaaaaaggt gactaaagaa gatgttctga acgccctgaa aaacgtgatc    60
  61 gattttgaac tcggtctgga tgtggtgagt ctgggtttgg tgtacgacat ccagatagac   120
 121 gatcagaaca acgtgaaggt cctcatgacg atgaccacac ccatgtgtcc tctcgccgga   180
 181 atgattcttt ccgacgccga agaggcgata aagaagatcg aaggagtcaa caacgtggag   240
 241 gtggagctca cattcgaccc accatggaca ccagaaagaa tgtctccgga gctgagagaa   300
 301 aaatttggag tc   312
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
518115 518429 3 Glimmer3 score - -
Genemark probabilities .78   .95 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu