LOADING...
   TM0486;TM0486
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0486    TM0486            JCSG 282359 PDB Deposition 04-MAY-05              PDB id: 1vk8

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0486
DESCRIPTIONTM0486 (DUF77 family) thiamin-binding protein [MTH1187-like].
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYV6_THEMA
DR SPTR; Q9WYV6 (flat text); Q9WYV6 (good view)
DR GenBank; AAD35571
DR Pfam; PF01910; DUF77;
DR Interpro; IPR002767; DUF77;
DR PDB; 1VK8; Identical; 18-MAY-04; HYPOTHETICAL PROTEIN TM0486;
DR FFAS; 282359; Fold and function assignment.
DR TVPC; TM0486; Homologs in PDB, JCSG and SG center.
DR OVP; TM0486; Ortholog view popup.
DR TPM; TM0486; Target PDB monitor.
DR FSS; TM0486; Target function coverage.
PROPERTY Residues: 94 aa
Molecule Weight: 10804.93 Dalton
Isoelectric Point: 5.46
Extinction Coefficient: 11460
Gravy Index: -.35
Number of Met residues: 3
Percentage of Met residues: 3.19 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 94 aa
>TM0486  TM0486 conserved hypothetical protein
MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKEL
ARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYR

CDS  cDNA 282 bp
   1 atgccgaaag taacggtttc cataaaggtg gttcccgccg tggaagatgg aagactccac    60
  61 gaggtgatcg acagagcgat cgaaaagatc tcttcatggg gcatgaaata cgaagtgggt   120
 121 ccctccaaca ccaccgtgga aggtgaattc gaagaaatca tggatcgtgt gaaagagctt   180
 181 gccagatacc ttgaacagtt cgcgaaacga ttcgttctac agctggacat cgattacaaa   240
 241 gctggaggta tcacgattga agagaaggta tcgaagtacc gc   282
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
517764 518048 -3 Glimmer3 score 15.91 good
Genemark probabilities .82   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu