LOADING...
   TM0449;TM0449
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0449    TM0449            JCSG 282322 PDB Deposition 02-JAN-03              PDB id: 1kq4

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0449
DESCRIPTIONThy1-Complementing Protein Thymidylate synthase thyX (EC 2.1.1.) (TS) (TSase).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CATALYZES THE FORMATION OF DTMP AND TETRAHYDROFOLATE
FROM DUMP AND METHYLENETETRAHYDROFOLATE.
-!- COFACTOR: BINDS 1 FAD PER SUBUNIT.
-!- SUBUNIT: HOMOTETRAMER.
-!- SIMILARITY: BELONGS TO THE THYMIDYLATE SYNTHASE THYX/THY1 FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; THYX_THEMA
DR SPTR; Q9WYT0 (flat text); Q9WYT0 (good view)
DR GenBank; AAD35532
DR Pfam; PF02511; Thy1;
DR Interpro; IPR003669; Thy1;
DR PDB; 1KQ4; Identical; 27-FEB-02; HYPOTHETICAL PROTEIN TM0449;
DR PDB; 1O24; Identical; 24-JUN-03; THYMIDYLATE SYNTHASE THYX;
DR PDB; 1O25; Identical; 24-JUN-03; THYMIDYLATE SYNTHASE THYX;
DR PDB; 1O26; Identical; 24-JUN-03; THYMIDYLATE SYNTHASE THYX;
DR PDB; 1O27; Identical; 24-JUN-03; THYMIDYLATE SYNTHASE THYX;
DR PDB; 1O28; Identical; 24-JUN-03; THYMIDYLATE SYNTHASE THYX;
DR PDB; 1O29; Identical; 24-JUN-03; THYMIDYLATE SYNTHASE THYX;
DR PDB; 1O2A; Identical; 24-JUN-03; THYMIDYLATE SYNTHASE THYX;
DR KEGG; 2.1.1.148; Enzyme page
DR FFAS; 282322; Fold and function assignment.
DR TVPC; TM0449; Homologs in PDB, JCSG and SG center.
DR OVP; TM0449; Ortholog view popup.
DR TPM; TM0449; Target PDB monitor.
DR FSS; TM0449; Target function coverage.
PROPERTY Residues: 220 aa
Molecule Weight: 26002.69 Dalton
Isoelectric Point: 7.83
Extinction Coefficient: 39880
Gravy Index: -.25
Number of Met residues: 5
Percentage of Met residues: 2.27 %
Number of Cys residues: 1
Percentage of Cys residues: 0.45 %
SEQUENCE  amino acids 220 aa
>TM0449  TM0449 thy1 protein
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHI
VFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTE
KISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQ
WEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV

CDS  cDNA 660 bp
   1 atgaagatcg atatcttgga caaaggattc gttgaacttg tggatgtgat gggaaacgac    60
  61 ctctccgctg tacgggctgc ccgcgtttct ttcgatatgg gtttgaaaga cgaagaaagg   120
 121 gatagacatc tcatcgaata tctcatgaaa cacggtcacg agacaccttt cgaacatatt   180
 181 gtcttcactt tccacgtgaa agcccctata ttcgtggcga ggcagtggtt cagacacagg   240
 241 atcgcttctt acaacgaact gagcggcaga tactcgaagc tctcctacga attctacatt   300
 301 ccctctcccg aacgcctgga agggtacaaa acgaccatcc ctcccgaacg ggtgacggag   360
 361 aagatctcag aaatagtcga taaagcgtat cgaacgtatc tggagttgat agaaagcggt   420
 421 gttcctcgag aagtggcaag gatagtgctc cctttgaatc tgtacacgag gtttttctgg   480
 481 actgtgaacg caagaagtct catgaacttt ttgaacctga gggcagattc tcacgctcag   540
 541 tgggaaattc aacagtacgc tctggcaatc gcgagaattt tcaaagagaa gtgtccctgg   600
 601 acttttgagg catttcttaa gtatgcttat aaaggagata tcctgaagga ggtacaggta   660
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
472959 473621 -3 Glimmer3 score 8.12 poor
Genemark probabilities .88   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu