LOADING...
   TM0446;TM0446
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0446    TM0446            JCSG 282319 PDB Deposition 03-JUL-11              PDB id: 1o4v

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0446
DESCRIPTIONPhosphoribosylaminoimidazole mutase catalytic subunit
(EC 4.1.1.21) (AIR carboxylase) (AIRC).
ORGANISMThermotoga maritima
COMMENT Perfect genome and functional context: clustering on a chromosome with another enzyme of De novo Purine biosynthesis subsystem:
TM0447 - Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)

-!- FUNCTION: THIS SUBUNIT CAN ALONE TRANSFORM AIR TO CAIR, BUT IN
ASSOCIATION WITH PURK, WHICH POSSESSES AN ATPASE ACTIVITY, AN
ENZYME COMPLEX IS PRODUCED WHICH IS CAPABLE OF CONVERTING AIR TO
CAIR EFFICIENTLY UNDER PHYSIOLOGICAL CONDITION (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: 5-AMINO-1-(5-PHOSPHO-D-RIBOSYL)IMIDAZOLE-4-
CARBOXYLATE = 5-AMINO-1-(5-PHOSPHO-D-RIBOSYL)IMIDAZOLE + CO(2).
-!- PATHWAY: DE NOVO PURINE BIOSYNTHESIS; SIXTH STEP.
-!- SUBUNIT: HOMOOCTAMER (BY SIMILARITY).
-!- SIMILARITY: TO OTHER BACTERIAL PURE, ALSO TO AIR CARBOXYLASE FROM
FUNGI.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PUR6_THEMA
DR SPTR; Q9WYS7 (flat text); Q9WYS7 (good view)
DR GenBank; AAD35541
DR Pfam; PF00731; AIRC;
DR Interpro; IPR000031; AIR_carboxyl;
DR PDB; 1O4V; Identical; 22-JUL-03; PHOSPHORIBOSYLAMINOIMIDAZOLE MUTASE PURE;
DR PDB; 3OOW; Highly similar; 15-SEP-10; PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE,CATALYIC CHAIN: A,;
DR PDB; 3OPQ; Highly similar; 17-NOV-10; PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE,CATALYIC CHAIN: A,;
DR PDB; 1XMP; Highly similar; 16-NOV-04; PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE;
DR PDB; 4B4K; Highly similar; 08-AUG-12; N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE;
DR PDB; 4AY3; Highly similar; 30-JAN-13; N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE;
DR PDB; 4AY4; Highly similar; 30-JAN-13; N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE;
DR PDB; 3LP6; Highly similar; 16-JUN-10; PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE CATALYTI CHAIN: A,;
DR KEGG; 4.1.1.21; Enzyme page
DR FFAS; 282319; Fold and function assignment.
DR TVPC; TM0446; Homologs in PDB, JCSG and SG center.
DR OVP; TM0446; Ortholog view popup.
DR TPM; TM0446; Target PDB monitor.
DR FSS; TM0446; Target function coverage.
PROPERTY Residues: 171 aa
Molecule Weight: 18616.67 Dalton
Isoelectric Point: 6.33
Extinction Coefficient: 8940
Gravy Index: -.03
Number of Met residues: 7
Percentage of Met residues: 4.09 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 171 aa
>TM0446  TM0446 phosphoribosylaminoimidazole carboxylase, catalytic subunit (purE)
MPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVI
IAGAGGAAHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINNAKN
AGILAASILGIKYPEIARKVKEYKERMKREVLEKAQRLEQIGYKEYLNQKE

CDS  cDNA 513 bp
   1 gtgccaaggg taggaatcat catgggaagt gactccgatc ttcctgtaat gaagcaggca    60
  61 gctgaaattt tggaagaatt cggaatagat tacgagatta cgatcgtttc cgctcacagg   120
 121 acaccggatc gcatgttcga gtacgcaaag aacgccgaag aacggggaat agaagtgatc   180
 181 attgcgggag cggggggagc ggctcacctt ccaggaatgg tggcaagcat cacccacctt   240
 241 cctgtgatag gtgttcccgt gaaaacatcc acactgaacg gtctggattc tcttttctcc   300
 301 atagttcaga tgccaggggg tgtgcccgtt gccaccgttg ccataaacaa cgcgaagaac   360
 361 gcgggaatcc ttgctgcgtc tattctggga atcaaatatc cggagatcgc aaggaaggta   420
 421 aaagagtata aagaaagaat gaaacgggaa gttctggaaa aagcccaaag attagaacaa   480
 481 attggttaca aagaatatct gaaccagaaa gag   513
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
469168 469683 -1 Glimmer3 score 12.68 good
Genemark probabilities .86   .94 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu