LOADING...
   TM0441;TM0441
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0441    TM0441            JCSG 359776 PDB Deposition 04-JUL-14              PDB id: 1vl8

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0441
DESCRIPTIONGluconate 5-dehydrogenase (EC 1.1.1.69)
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE SHORT-CHAIN DEHYDROGENASES/REDUCTASES
(SDR) FAMILY.
DR UNIPROT; Q9WYS2_THEMA
DR SPTR; Q9WYS2 (flat text); Q9WYS2 (good view)
DR GenBank; AAD35526
DR Pfam; PF00106; adh_short;
DR Interpro; IPR002198; ADH_short;
DR PDB; 1VL8; Identical; 17-AUG-04; GLUCONATE 5-DEHYDROGENASE;
DR PDB; 4J2H; Highly similar; 01-MAY-13; SHORT CHAIN ALCOHOL DEHYDROGENASE-RELATED DEHYDRO CHAIN: A;
DR PDB; 4G81; Highly similar; 15-AUG-12; PUTATIVE HEXONATE DEHYDROGENASE;
DR PDB; 4IBO; Highly similar; 26-DEC-12; GLUCONATE DEHYDROGENASE;
DR PDB; 4NBU; Highly similar; 04-DEC-13; 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE;
DR PDB; 2B4Q; Highly similar; 02-MAY-06; RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL- CARRIER-PROTEIN];
DR PDB; 3AY7; Highly similar; 23-MAY-12; GLUCOSE 1-DEHYDROGENASE 4;
DR PDB; 1AE1; Highly similar; 18-NOV-98; TROPINONE REDUCTASE-I;
DR KEGG; 1.1.1.69; Enzyme page
DR FFAS; 282314; Fold and function assignment.
DR TVPC; TM0441; Homologs in PDB, JCSG and SG center.
DR OVP; TM0441; Ortholog view popup.
DR TPM; TM0441; Target PDB monitor.
DR FSS; TM0441; Target function coverage.
PROPERTY Residues: 255 aa
Molecule Weight: 27915.45 Dalton
Isoelectric Point: 5.52
Extinction Coefficient: 29910
Gravy Index: -.09
Number of Met residues: 5
Percentage of Met residues: 1.96 %
Number of Cys residues: 3
Percentage of Cys residues: 1.18 %
SEQUENCE  amino acids 255 aa
>TM0441  TM0441 oxidoreductase, short chain dehydrogenase/reductase family
MKEVFDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEASEAAQKLTEKYGVE
TMAFRCDVSNYEEVKKLLEAVKEKFGKLDTVVNAAGINRRHPAEEFPLDEFRQVIEVNLF
GTYYVCREAFSLLRESDNPSIINIGSLTVEEVTMPNISAYAASKGGVASLTKALAKEWGR
YGIRVNVIAPGWYRTKMTEAVFSDPEKLDYMLKRIPLGRTGVPEDLKGVAVFLASEEAKY
VTGQIIFVDGGWTAN

CDS  cDNA 765 bp
   1 gtgaaagagg tgttcgatct cagggggagg gttgccctcg taaccggtgg ctctcgtggg    60
  61 ctgggttttg gaatcgctca ggggctggca gaggccggat gttcagtggt cgttgcaagc   120
 121 agaaatctgg aggaagcatc agaagcggct caaaagttga cagaaaaata cggtgttgaa   180
 181 acgatggctt tccgatgcga tgtttcaaac tatgaggaag tgaaaaaact tttggaagca   240
 241 gtgaaagaga aatttggaaa gctcgatacg gtggtcaacg ctgcggggat aaacagaaga   300
 301 catccagcgg aagaatttcc tctcgatgag ttcagacagg tgatagaggt gaaccttttt   360
 361 ggaacttact acgtgtgtag ggaggccttt tcactcctga gagaatccga taacccctct   420
 421 atcataaaca taggatctct caccgttgaa gaagtcacca tgcccaacat atccgcgtac   480
 481 gctgcttcga aagggggcgt agcttctctc acaaaagctc tggcgaagga atggggaagg   540
 541 tacggcataa gggtgaatgt gatagcgccg ggctggtaca gaaccaagat gacagaggct   600
 601 gtgttcagcg atccagaaaa actggactac atgctcaaga ggatacccct tggcagaacg   660
 661 ggtgtaccag aggatttgaa gggtgtggca gtcttccttg cttccgaaga ggcgaagtac   720
 721 gtgactggac agatcatatt tgtagacggt ggttggactg cgaat   765
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
462981 463748 3 Glimmer3 score - -
Genemark probabilities .9   .89 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu