LOADING...
   TM0436;TM0436
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0436    TM0436            JCSG 282309 PDB Deposition 03-DEC-02              PDB id: 1vj0

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0436
DESCRIPTIONAlcohol dehydrogenase, zinc-containing.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYR7_THEMA
DR SPTR; Q9WYR7 (flat text); Q9WYR7 (good view)
DR GenBank; AAD35521
DR Pfam; PF08240; ADH_N;
DR Pfam; PF00107; ADH_zinc_N;
DR Interpro; IPR002085; Adh_zn_family;
DR PDB; 1VJ0; Identical; 02-MAR-04; ALCOHOL DEHYDROGENASE, ZINC-CONTAINING;
DR PDB; 3GFB; Highly similar; 06-OCT-09; L-THREONINE 3-DEHYDROGENASE;
DR PDB; 4CPD; Highly similar; 17-DEC-14; ALCOHOL DEHYDROGENASE;
DR FFAS; 282309; Fold and function assignment.
DR TVPC; TM0436; Homologs in PDB, JCSG and SG center.
DR OVP; TM0436; Ortholog view popup.
DR TPM; TM0436; Target PDB monitor.
DR FSS; TM0436; Target function coverage.
PROPERTY Residues: 368 aa
Molecule Weight: 40555.61 Dalton
Isoelectric Point: 6.04
Extinction Coefficient: 39880
Gravy Index: -.06
Number of Met residues: 8
Percentage of Met residues: 2.17 %
Number of Cys residues: 8
Percentage of Cys residues: 2.17 %
SEQUENCE  amino acids 368 aa
>TM0436  TM0436 alcohol dehydrogenase, zinc-containing
MMGLKAHAMVLEKFNQPLVYKEFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVPLP
IILGHEGAGRVVEVNGEKRDLNGELLKPGDLIVWNRGITCGECYWCKVSKEPYLCPNRKV
YGINRGCSEYPHLRGCYSSHIVLDPETDVLKVSEKDDLDVLAMAMCSGATAYHAFDEYPE
SFAGKTVVIQGAGPLGLFGVVIARSLGAENVIVIAGSPNRLKLAEEIGADLTLNRRETSV
EERRKAIMDITHGRGADFILEATGDSRALLEGSELLRRGGFYSVAGVAVPQDPVPFKVYE
WLVLKNATFKGIWVSDTSHFVKTVSITSRNYQLLSKLITHRLPLKEANKALELMESREAL
KVILYPEG

CDS  cDNA 1104 bp
   1 gtgatggggt tgaaagctca cgccatggtg ctcgaaaagt tcaatcaacc tcttgtatat    60
  61 aaagaattcg agatctcaga cattccacga ggatctattc tggttgaaat tctctctgca   120
 121 ggtgtttgtg gttccgatgt tcacatgttt cgcggagaag atcccagagt acctcttccc   180
 181 atcatcctgg ggcacgaggg tgcaggaaga gttgtcgaag tgaacggaga aaagagagat   240
 241 ctcaatggag aactccttaa acccggtgat ttgatagtct ggaatagggg tatcacctgt   300
 301 ggtgaatgtt actggtgtaa ggtgtcaaaa gaaccttatc tctgtccaaa cagaaaggtc   360
 361 tatggaataa acaggggatg ttctgagtat cctcacctca ggggatgcta cagttctcac   420
 421 attgtgctgg acccagaaac agacgtttta aaggtatcgg aaaaagacga tctcgatgtt   480
 481 cttgccatgg cgatgtgttc aggagcaact gcataccacg cgtttgatga gtatcctgaa   540
 541 tcctttgctg ggaagaccgt tgttatacag ggagcaggac ctttgggatt gtttggagtt   600
 601 gttatagcaa ggagtcttgg tgcggagaat gtgattgtaa tagcgggttc tccgaacagg   660
 661 ctgaaacttg ccgaagaaat aggagcagat ctcacattga acagaagaga aacgagtgtt   720
 721 gaggagagaa gaaaagcaat aatggacatc acacacggta gaggagcaga ttttatcctg   780
 781 gaagcgacgg gggacagcag agcacttctc gaaggatctg agttactgag aagaggagga   840
 841 ttttactctg ttgcgggggt agctgtgcca caggatcctg taccttttaa agtttacgaa   900
 901 tggcttgttt tgaagaacgc gactttcaag ggaatctggg tcagtgatac ttcacacttt   960
 961 gtgaagacgg tttcaatcac gtccaggaat tatcaacttc tttccaagct catcacgcac  1020
1021 agacttcctt tgaaagaggc aaacaaagcc ctggaactca tggaatcgag agaggctttg  1080
1081 aaagtaatcc tttatccgga ggga  1104
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
457014 458120 3 Glimmer3 score - -
Genemark probabilities .82   .99 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu