LOADING...
   TM0423;TM0423
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0423    TM0423            JCSG 282296 PDB Deposition 02-JAN-03              PDB id: 1kq3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0423
DESCRIPTIONGlycerol dehydrogenase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYQ4_THEMA
DR SPTR; Q9WYQ4 (flat text); Q9WYQ4 (good view)
DR GenBank; AAD35508
DR Pfam; PF00465; Fe-ADH;
DR Interpro; IPR002086; Aldehyde_dehydr;
DR Interpro; IPR001670; Fe-ADH;
DR PDB; 1KQ3; Identical; 27-FEB-02; GLYCEROL DEHYDROGENASE;
DR PDB; 4MCA; Highly similar; 12-FEB-14; GLYCEROL DEHYDROGENASE;
DR PDB; 1JQ5; Highly similar; 01-OCT-01; GLYCEROL DEHYDROGENASE;
DR PDB; 1JPU; Highly similar; 03-OCT-01; GLYCEROL DEHYDROGENASE;
DR PDB; 1JQA; Highly similar; 03-OCT-01; GLYCEROL DEHYDROGENASE;
DR PDB; 3UHJ; Highly similar; 23-NOV-11; PROBABLE GLYCEROL DEHYDROGENASE;
DR PDB; 1TA9; Highly similar; 16-AUG-05; GLYCEROL DEHYDROGENASE;
DR KEGG; 1.1.1.6; Enzyme page
DR FFAS; 282296; Fold and function assignment.
DR TVPC; TM0423; Homologs in PDB, JCSG and SG center.
DR OVP; TM0423; Ortholog view popup.
DR TPM; TM0423; Target PDB monitor.
DR FSS; TM0423; Target function coverage.
PROPERTY Residues: 364 aa
Molecule Weight: 39689.39 Dalton
Isoelectric Point: 5.17
Extinction Coefficient: 21890
Gravy Index: -.01
Number of Met residues: 7
Percentage of Met residues: 1.92 %
Number of Cys residues: 6
Percentage of Cys residues: 1.65 %
SEQUENCE  amino acids 364 aa
>TM0423  TM0423 glycerol dehydrogenase (gldA)
MITTTIFPGRYVQGAGAINILEEELSRFGERAFVVIDDFVDKNVLGENFFSSFTKVRVNK
QIFGGECSDEEIERLSGLVEEETDVVVGIGGGKTLDTAKAVAYKLKKPVVIVPTIASTDA
PCSALSVIYTPNGEFKRYLFLPRNPDVVLVDTEIVAKAPARFLVAGMGDALATWFEAESC
KQKYAPNMTGRLGSMTAYALARLCYETLLEYGVLAKRSVEEKSVTPALEKIVEANTLLSG
LGFESGGLAAAHAIHNGLTVLENTHKYLHGEKVAIGVLASLFLTDKPRKMIEEVYSFCEE
VGLPTTLAEIGLDGVSDEDLMKVAEKACDKNETIHNEPQPVTSKDVFFALKAADRYGRMR
KNLT

CDS  cDNA 1092 bp
   1 atgataacaa ccaccatatt tccaggtaga tatgttcagg gggcaggtgc tatcaacatt    60
  61 ctagaagaag aactttctcg ttttggagaa agggcatttg tggtgatcga tgattttgtg   120
 121 gacaaaaacg tgctaggaga aaatttcttc agctctttca caaaagtcag ggtaaacaaa   180
 181 cagatctttg gtggagagtg ttcagacgaa gagatagagc gactttcagg tcttgttgaa   240
 241 gaagaaacag acgtggtggt gggcataggt ggcggaaaaa cactcgatac cgctaaagcg   300
 301 gtcgcctata agttgaaaaa gcctgttgtg attgttccaa ctattgcctc tacagatgct   360
 361 ccatgcagcg ccctttccgt gatttacaca ccaaacgggg aattcaaaag atacctgttt   420
 421 ttgccaagga atccagatgt cgttctggta gacacggaga ttgtggcgaa agcccccgcg   480
 481 aggtttcttg ttgccggaat gggagatgcc cttgccacgt ggtttgaggc agaatcttgt   540
 541 aaacagaaat acgctccaaa tatgacggga agacttggtt cgatgacagc ctacgcgctc   600
 601 gcaagacttt gctatgagac acttctagaa tacggtgtac ttgcgaaaag gtcggtggag   660
 661 gaaaagtctg tcacacctgc ccttgaaaaa atcgttgagg cgaacaccct tttaagtggt   720
 721 ctgggattcg aaagtggagg actggcagct gcacatgcta ttcacaacgg tctcaccgtt   780
 781 ctggaaaata cccacaagta tttacacggg gaaaaagtgg ccataggagt tctcgcatca   840
 841 ctgtttttga ctgacaaacc cagaaagatg atcgaagagg tctactcctt ctgtgaagaa   900
 901 gtgggattac ccactactct ggcagagata ggacttgatg gtgtttcgga cgaggatctg   960
 961 atgaaagtgg ctgagaaagc ctgtgacaag aatgaaacaa tacacaacga accccaacct  1020
1021 gtgacatcaa aggatgtgtt tttcgcccta aaagcagcag acaggtacgg aaggatgaga  1080
1081 aaaaacctca ct  1092
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
440773 441867 -1 Glimmer3 score 10.32 poor
Genemark probabilities .87   .06 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu