LOADING...
   TM0415;TM0415
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0415    TM0415            JCSG 282288 PDB Deposition 04-APR-26              PDB id: 1vk4

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0415
DESCRIPTIONCarbohydrate kinase, PfkB family
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYP6_THEMA
DR SPTR; Q9WYP6 (flat text); Q9WYP6 (good view)
DR GenBank; AAD35500
DR PDB; 1VK4; Identical; 04-MAY-04; PFKB CARBOHYDRATE KINASE TM0415;
DR FFAS; 282288; Fold and function assignment.
DR TVPC; TM0415; Homologs in PDB, JCSG and SG center.
DR OVP; TM0415; Ortholog view popup.
DR TPM; TM0415; Target PDB monitor.
DR FSS; TM0415; Target function coverage.
PROPERTY Residues: 286 aa
Molecule Weight: 32059.93 Dalton
Isoelectric Point: 6.47
Extinction Coefficient: 28420
Gravy Index: -.16
Number of Met residues: 6
Percentage of Met residues: 2.10 %
Number of Cys residues: 3
Percentage of Cys residues: 1.05 %
SEQUENCE  amino acids 286 aa
>TM0415  TM0415 hypothetical protein
MITFIGHVSKDVNVVDGKREIAYGGGVVMGAITSSLLGVKTKVITKCTREDVSKFSFLRD
NGVEVVFLKSPRTTSIENRYGSDPDTRESFLISAADPFTESDLAFIEGEAVHINPLWYGE
FPEDLIPVLRRKVMFLSADAQGFVRVPENEKLVYRDWEMKEKYLKYLDLFKVDSREAETL
TGTNDLRESCRIIRSFGAKIILATHASGVIVFDGNFYEASFRSWSLEGRTGRGDTCTAAF
LVGFVFKKMSIEKATKFAAAVTSVKMRHPGPLRREDLEAISGDQYF

CDS  cDNA 858 bp
   1 atgatcacct tcattgggca tgtatcgaaa gacgtcaacg tggtagatgg aaagagggag    60
  61 atcgcgtacg gtgggggagt ggtgatgggg gccatcacct cctcgctgct cggtgtgaaa   120
 121 acaaaagtga ttacaaaatg cacgagagag gacgtttcaa agttttcttt tctccgagac   180
 181 aatggtgtgg aagtggtgtt tctgaaaagt cctagaacaa ccagcattga gaacaggtac   240
 241 ggatcagatc ctgacacgag ggagagtttt ttgatatcgg cggcggatcc gttcactgaa   300
 301 agtgacctgg cattcatcga aggagaggcg gttcatatca acccgctctg gtatggagag   360
 361 tttccggagg atctcatacc tgttttgcga aggaaagtga tgtttctctc tgccgacgcg   420
 421 caggggtttg taagagtgcc agaaaatgaa aaactcgttt acagagactg ggagatgaaa   480
 481 gagaaatatt tgaagtacct cgatctcttc aaggtggaca gcagggaagc agaaacactc   540
 541 acgggaacga acgacttgag agagtcgtgc aggatcatcc gttcttttgg tgcgaagatc   600
 601 attctggcaa cacatgcgag cggtgtgata gtcttcgatg gaaacttcta cgaagcttca   660
 661 ttcagaagtt ggtcactgga aggtagaacg ggaagagggg acacctgtac tgcggcgttt   720
 721 ctcgttggat tcgtcttcaa aaagatgagc atcgagaagg caacaaaatt cgcggctgct   780
 781 gtaacttctg taaagatgag acatcctgga ccactgagga gggaggatct tgaagctatc   840
 841 tctggtgatc agtacttc   858
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
433054 433914 1 Glimmer3 score 11.2 poor
Genemark probabilities .84   .8 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu