LOADING...
   TM0378;TM0378
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0378    TM0378            JCSG 354146 PDB Deposition 05-MAR-29              PDB id: 1z82

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0378
DESCRIPTIONglycerol-3-phosphate dehydrogenase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07479; NAD_Gly3P_dh_C;
DR Pfam; PF01210; NAD_Gly3P_dh_N;
DR PDB; 1Z82; Identical; 12-APR-05; GLYCEROL-3-PHOSPHATE DEHYDROGENASE;
DR PDB; 3K96; Highly similar; 27-OCT-09; GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+];
DR PDB; 1EVY; Highly similar; 22-FEB-01; GLYCEROL-3-PHOSPHATE DEHYDROGENASE;
DR PDB; 1EVZ; Highly similar; 22-FEB-01; GLYCEROL-3-PHOSPHATE DEHYDROGENASE;
DR PDB; 1JDJ; Highly similar; 14-JUN-02; GLYCEROL-3-PHOSPHATE DEHYDROGENASE;
DR PDB; 1M66; Highly similar; 11-DEC-02; GLYCEROL-3-PHOSPHATE DEHYDROGENASE;
DR PDB; 1M67; Highly similar; 11-DEC-02; GLYCEROL-3-PHOSPHATE DEHYDROGENASE;
DR PDB; 1N1E; Highly similar; 27-MAY-03; GLYCEROL-3-PHOSPHATE DEHYDROGENASE;
DR FFAS; 354146; Fold and function assignment.
DR TVPC; TM0378; Homologs in PDB, JCSG and SG center.
DR OVP; TM0378; Ortholog view popup.
DR TPM; TM0378; Target PDB monitor.
DR FSS; TM0378; Target function coverage.
PROPERTY Residues: 329 aa
Molecule Weight: 36707.62 Dalton
Isoelectric Point: 6.2
Extinction Coefficient: 35410
Gravy Index: -.03
Number of Met residues: 11
Percentage of Met residues: 3.34 %
Number of Cys residues: 3
Percentage of Cys residues: 0.91 %
SEQUENCE  amino acids 329 aa
>TM0378  TM0378
MEMRFFVLGAGSWGTVFAQMLHENGEEVILWARRKEIVDLINVSHTSPYVEESKITVRAT
NDLEEIKKEDILVIAIPVQYIREHLLRLPVKPSMVLNLSKGIEIKTGKRVSEIVEEILGC
PYAVLSGPSHAEEVAKKLPTAVTLAGENSKELQKRISTEYFRVYTCEDVVGVEIAGALKN
VIAIAAGILDGFGGWDNAKAALETRGIYEIARFGMFFGADQKTFMGLAGIGDLMVTCNSR
YSRNRRFGELIARGFNPLKLLESSNQVVEGAFTVKAVMKIAKENKIDMPISEEVYRVVYE
GKPPLQSMRDLMRRSLKDEFWASVVDSSL

CDS  cDNA 0 bp
   1       1
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu