LOADING...
   TM0343;TM0343
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0343    TM0343            JCSG 282218 PDB Deposition 05-FEB-14              PDB id: 1vr6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0343
DESCRIPTIONPhospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) (DAHP synthase)
ORGANISMThermotoga maritima
COMMENT Genomic context is perfect around DAHP synthase: very strong cluster
(TM0343 - TM0348) in chorismate biosynthesis pathway
(KEGG MAP00400: Phenylalanine, tyrosine and tryptophan biosynthesis).
Functional context: strongly supportive ( complete functional pathway in chorismate biosynthesis ).
The paper enclosed is an experimental characterization of TM0343.
DR UNIPROT; AROF_THEMA
DR SPTR; Q9WYH8 (flat text); Q9WYH8 (good view)
DR GenBank; AAD35429
DR Pfam; PF00793; DAHP_synth_1;
DR Interpro; IPR006218; DAHP1/KDSA;
DR Interpro; IPR006268; DAHP_syn_2;
DR PDB; 1RZM; Identical; 10-AUG-04; PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE;
DR PDB; 3PG9; Identical; 26-JAN-11; PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE;
DR PDB; 1VR6; Identical; 08-MAR-05; PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE;
DR PDB; 3PG8; Identical; 26-JAN-11; PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE;
DR PDB; 4GRS; Highly similar; 06-FEB-13; PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE, 2-DE DEOXYPHOSP;
DR PDB; 1ZCO; Highly similar; 18-OCT-05; 2-DEHYDRO-3-DEOXYPHOSPHOHEPTONATE ALDOLASE;
DR PDB; 4C1K; Highly similar; 20-NOV-13; 2-DEHYDRO-3-DEOXYPHOSPHOHEPTONATE ALDOLASE;
DR PDB; 4C1L; Highly similar; 20-NOV-13; 2-DEHYDRO-3-DEOXYPHOSPHOHEPTONATE ALDOLASE;
DR KEGG; 2.5.1.54; Enzyme page
DR FFAS; 282218; Fold and function assignment.
DR TVPC; TM0343; Homologs in PDB, JCSG and SG center.
DR OVP; TM0343; Ortholog view popup.
DR TPM; TM0343; Target PDB monitor.
DR FSS; TM0343; Target function coverage.
PROPERTY Residues: 338 aa
Molecule Weight: 37376.12 Dalton
Isoelectric Point: 6.22
Extinction Coefficient: 17880
Gravy Index: -.12
Number of Met residues: 6
Percentage of Met residues: 1.78 %
Number of Cys residues: 4
Percentage of Cys residues: 1.18 %
SEQUENCE  amino acids 338 aa
>TM0343  TM0343 chorismate mutase, putative
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVE
SVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSVEGREMLMETAHFLSEL
GVKVLRGGAYKPRTSPYSFQGLGEKGLEYLREAADKYGMYVVTEALGEDDLPKVAEYADI
IQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKIILCERGIR
TFEKATRNTLDISAVPIIRKESHLPILVDPSHSGGRRDLVIPLSRAAIAVGAHGIIVEVH
PEPEKALSDGKQSLDFELFKELVQEMKKLADALGVKVN

CDS  cDNA 1014 bp
   1 atgatagtcg ttttgaaacc cggttccaca gaagaagata taaggaaggt ggtgaagttg    60
  61 gccgagagtt acaacttgaa gtgtcacatt tccaaaggtc aggaaagaac ggttattggg   120
 121 atcatcgggg acgacaggta cgtggtggcg gacaagttcg agtcgctgga ttgcgtggaa   180
 181 agcgttgtga gggtgctcaa accttacaaa ctcgtttctc gtgagttcca tccggaggac   240
 241 acggtgatcg acctcggaga tgtgaagata ggaaacggct acttcaccat catagcggga   300
 301 ccgtgctcag ttgaaggcag ggaaatgctc atggaaaccg cacacttttt aagcgaactc   360
 361 ggtgttaaag ttttgagggg aggggcctac aagcctcgaa catctcctta ctctttccaa   420
 421 ggactcggag aaaaggggct ggaatacctg agagaggctg ccgacaagta cggtatgtac   480
 481 gtggtgacgg aggctctcgg agaagacgat cttccaaaag tggccgagta cgctgatatc   540
 541 attcagatag gagcgagaaa cgctcagaac ttcagattgc tctctaaagc gggaagctac   600
 601 aacaaacccg ttcttctgaa aaggggtttc atgaacacca tcgaagagtt ccttctctcc   660
 661 gctgaataca ttgcaaactc tggaaacacg aagatcatac tgtgtgaaag gggaatcaga   720
 721 acgttcgaaa aggccacgag gaacacactc gatatatccg ctgttcctat aatcagaaag   780
 781 gaatcccatc ttcccattct ggtggatccg agccactctg ggggaagaag agacctcgtt   840
 841 attccactct cccgggccgc tatagcggtt ggagctcatg gaatcattgt ggaggttcat   900
 901 ccggagccgg agaaggcact ttcggatgga aaacagagtc ttgacttcga gctcttcaag   960
 961 gaactggttc aggaaatgaa gaaactcgct gatgccctgg gggtgaaggt gaat  1014
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
361173 362189 3 Glimmer3 score 11.83 poor
Genemark probabilities .89   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu