LOADING...
   TM0332;TM0332
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0332    TM0332            JCSG 282207 PDB Deposition 05-JAN-04              PDB id: 1vqt

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0332
DESCRIPTIONOrotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: OROTIDINE 5'-PHOSPHATE = UMP + CO(2).
-!- PATHWAY: PYRIMIDINE BIOSYNTHESIS; SIXTH (LAST) STEP.
-!- SUBUNIT: HOMODIMER (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE OMP DECARBOXYLASE FAMILY. SUBFAMILY 1.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PYRF_THEMA
DR SPTR; Q9WYG7 (flat text); Q9WYG7 (good view)
DR GenBank; AAD35419
DR Pfam; PF00215; OMPdecase;
DR Interpro; IPR001754; OMPdecase;
DR PDB; 1VQT; Identical; 18-JAN-05; OROTIDINE 5'-PHOSPHATE DECARBOXYLASE;
DR PDB; 3RU6; Highly similar; 18-MAY-11; OROTIDINE 5'-PHOSPHATE DECARBOXYLASE;
DR PDB; 4LUI; Highly similar; 07-AUG-13; OROTIDINE 5'-PHOSPHATE DECARBOXYLASE;
DR PDB; 4LUJ; Highly similar; 07-AUG-13; OROTIDINE 5'-PHOSPHATE DECARBOXYLASE;
DR KEGG; 4.1.1.23; Enzyme page
DR FFAS; 282207; Fold and function assignment.
DR TVPC; TM0332; Homologs in PDB, JCSG and SG center.
DR OVP; TM0332; Ortholog view popup.
DR TPM; TM0332; Target PDB monitor.
DR FSS; TM0332; Target function coverage.
PROPERTY Residues: 201 aa
Molecule Weight: 22807.49 Dalton
Isoelectric Point: 6.97
Extinction Coefficient: 15470
Gravy Index: -.17
Number of Met residues: 7
Percentage of Met residues: 3.48 %
Number of Cys residues: 3
Percentage of Cys residues: 1.49 %
SEQUENCE  amino acids 201 aa
>TM0332  TM0332 orotidine 5'-phosphate decarboxylase, putative
MTPVLSLDMEDPIRFIDENGSFEVVKVGHNLAIHGKKIFDELAKRNLKIILDLKFCDIPS
TVERSIKSWDHPAIIGFTVHSCAGYESVERALSATDKHVFVVVKLTSMEGSLEDYMDRIE
KLNKLGCDFVLPGPWAKALREKIKGKILVPGIRMEVKADDQKDVVTLEEMKGIANFAVLG
REIYLSENPREKIKRIKEMRL

CDS  cDNA 603 bp
   1 atgacacctg ttctcagtct ggacatggaa gatcctatca gattcatcga cgaaaacggc    60
  61 agtttcgaag tggtgaaggt gggtcacaac ctcgccatac acgggaaaaa gatcttcgac   120
 121 gagctcgcaa agagaaattt gaagataatc ctcgacctga agttctgcga tatcccttca   180
 181 acggtggaac gttccataaa gagctgggat cacccggcga tcataggttt cacagttcac   240
 241 tcctgcgctg gatacgaaag cgtggagagg gctctcagtg caacagacaa acacgtgttc   300
 301 gttgtggtga aactcacttc catggaagga tccctcgagg attacatgga caggatagaa   360
 361 aaactgaaca agcttgggtg tgatttcgtg cttcccggtc catgggcaaa ggctctgaga   420
 421 gagaagataa aaggcaaaat tctcgttccc ggcatcagaa tggaagtgaa agcagacgat   480
 481 caaaaggacg tcgtaacgct cgaagagatg aagggaatag cgaattttgc tgtgctcgga   540
 541 agagagatct acctgagcga aaatcccaga gaaaagatca aaaggataaa ggagatgaga   600
 601 ctg   603
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
351942 352547 -3 Glimmer3 score 15.34 good
Genemark probabilities .91   .88 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu