LOADING...
   TM0320;TM0320
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0320    TM0320            JCSG 282196 PDB Deposition 10-JUN-09              PDB id: 2kyz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0320
DESCRIPTIONHeavy metal binding protein.
ORGANISMThermotoga maritima
COMMENTNo genome context.
Psi-Blast:No putative conserved domains have been detected.
Just a few homologs, not very close.
DR UNIPROT; Q9WYF6_THEMA
DR SPTR; Q9WYF6 (flat text); Q9WYF6 (good view)
DR GenBank; AAD35408
DR Pfam; PF00403; HMA;
DR Interpro; IPR006121; HeavyMe_transpt;
DR Interpro; IPR006191; Metal_bind;
DR PDB; 2KYZ; Identical; 07-JUL-10; HEAVY METAL BINDING PROTEIN;
DR PDB; 3FRY; Highly similar; 12-JAN-10; PROBABLE COPPER-EXPORTING P-TYPE ATPASE A;
DR FFAS; 282196; Fold and function assignment.
DR TVPC; TM0320; Homologs in PDB, JCSG and SG center.
DR OVP; TM0320; Ortholog view popup.
DR TPM; TM0320; Target PDB monitor.
DR FSS; TM0320; Target function coverage.
PROPERTY Residues: 67 aa
Molecule Weight: 7852.65 Dalton
Isoelectric Point: 4.78
Extinction Coefficient: 7450
Gravy Index: -.4
Number of Met residues: 2
Percentage of Met residues: 2.99 %
Number of Cys residues: 2
Percentage of Cys residues: 2.99 %
SEQUENCE  amino acids 67 aa
>TM0320  TM0320 heavy metal binding protein
MRYVLYVPDISCNHCKMRISKALEELGVKNYEVSVEEKKVVVETENLDSVLKKLEEIDYP
VESYQEV

CDS  cDNA 201 bp
   1 atgaggtacg ttctctatgt tccagatatt tcctgcaatc actgcaaaat gagaatttcg    60
  61 aaggcgctgg aagaattggg tgttaaaaac tacgaggtga gtgtggaaga gaagaaggtg   120
 121 gtcgttgaaa cggaaaatct ggacagtgtt ctgaagaaac tcgaggagat cgactatccg   180
 181 gtggagagtt accaggaagt c   201
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
342015 342218 3 Glimmer3 score 18.68 good
Genemark probabilities .78   .49 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu