LOADING...
   TM0312;TM0312
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0312    TM0312            JCSG 282188 PDB Deposition 05-APR-22              PDB id: 1zh8

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0312
DESCRIPTIONOxidoreductase (EC 1.1.1.-)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYE8_THEMA
DR SPTR; Q9WYE8 (flat text); Q9WYE8 (good view)
DR GenBank; AAD35400
DR Pfam; PF01408; GFO_IDH_MocA;
DR Interpro; IPR000683; GFO/IDH/MocA_N;
DR Interpro; IPR004104; GFO_IDH_MocA_C;
DR PDB; 1ZH8; Identical; 10-MAY-05; OXIDOREDUCTASE;
DR KEGG; 1.1.1.-; Enzyme page
DR FFAS; 282188; Fold and function assignment.
DR TVPC; TM0312; Homologs in PDB, JCSG and SG center.
DR OVP; TM0312; Ortholog view popup.
DR TPM; TM0312; Target PDB monitor.
DR FSS; TM0312; Target function coverage.
PROPERTY Residues: 328 aa
Molecule Weight: 36537.08 Dalton
Isoelectric Point: 5.69
Extinction Coefficient: 43430
Gravy Index: -.14
Number of Met residues: 7
Percentage of Met residues: 2.13 %
Number of Cys residues: 3
Percentage of Cys residues: 0.91 %
SEQUENCE  amino acids 328 aa
>TM0312  TM0312 conserved hypothetical protein
MKPLRKIRLGIVGCGIAARELHLPALKNLSHLFEITAVTSRTRSHAEEFAKMVGNPAVFD
SYEELLESGLVDAVDLTLPVELNLPFIEKALRKGVHVICEKPISTDVETGKKVVELSEKS
EKTVYIAENFRHVPAFWKAKELVESGAIGDPVFMNWQIWVGMDENNKYVHTDWRKKPKHV
GGFLSDGGVHHAAAMRLILGEIEWISAVAKDLSPLLGGMDFLSSIFEFENGTVGNYTISY
SLKGNERFEITGTKGKISISWDKIVLNEEEMKVPQENSYQKEFEDFYQVVAEGKPNDLGS
PVQALKDLAFIEACVRSAGNKVFVSSLL

CDS  cDNA 984 bp
   1 gtgaagcctt tgagaaaaat cagattgggt attgtggggt gtggaatcgc cgctcgagag    60
  61 ttgcaccttc ctgccttgaa gaatctttcc catctctttg agatcacggc tgtcacgagt   120
 121 agaacgaggt ctcacgctga agagttcgcg aaaatggtag gaaatcccgc tgttttcgat   180
 181 agctacgaag aacttttgga atctggcctt gttgacgcgg ttgatctaac gctccctgtt   240
 241 gaattgaacc tcccgttcat cgaaaaggcc cttcgaaaag gagtccatgt gatctgtgaa   300
 301 aaacccatct caacggacgt ggaaacagga aagaaggttg tcgagttgtc cgaaaaatct   360
 361 gaaaaaacag tctacatcgc ggagaatttc agacacgttc cggctttctg gaaggcaaaa   420
 421 gagctggttg agagcggagc gataggtgat cccgttttca tgaattggca gatctgggtg   480
 481 ggaatggacg aaaacaacaa atacgttcac actgactgga gaaagaagcc gaagcacgtt   540
 541 ggaggttttc tctcagacgg aggggtccac cacgctgcgg cgatgagact gatccttggt   600
 601 gagatagaat ggatttccgc cgttgcgaag gatctttctc cgcttcttgg gggaatggat   660
 661 tttctttcct ctatcttcga gttcgaaaac ggcacagttg gaaactacac gatttcttac   720
 721 tctctgaaag ggaacgagcg attcgaaatc acaggaacaa aaggaaagat ttccatatcc   780
 781 tgggacaaga tcgttctgaa cgaagaggaa atgaaagttc cacaggaaaa cagctatcag   840
 841 aaggagttcg aggatttcta tcaggtggtt gcggaaggaa aaccgaacga tctgggaagt   900
 901 ccggttcagg ctctgaaaga tcttgctttc atagaagcat gtgtgaggtc cgcgggaaac   960
 961 aaagtgttcg tttccagtct gttg   984
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
336187 337173 1 Glimmer3 score - -
Genemark probabilities .89   .71 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu