LOADING...
   TM0295;TM0295
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0295    TM0295            JCSG 282171 PDB Deposition 04-NOV-23              PDB id: 1vpx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0295
DESCRIPTIONTransaldolase (EC 2.2.1.2).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: TRANSALDOLASE IS IMPORTANT FOR THE BALANCE OF
METABOLITES IN THE PENTOSE-PHOSPHATE PATHWAY.
-!- CATALYTIC ACTIVITY: SEDOHEPTULOSE 7-PHOSPHATE + D-GLYCERALDEHYDE
3-PHOSPHATE = D-ERYTHROSE 4-PHOSPHATE + D-FRUCTOSE 6-PHOSPHATE.
-!- PATHWAY: PENTOSE PHOSPHATE PATHWAY; NONOXIDATIVE PART.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (PROBABLE).
-!- SIMILARITY: BELONGS TO THE TRANSALDOLASE FAMILY. SUBFAMILY 3B.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; TAL_THEMA
DR SPTR; Q9WYD1 (flat text); Q9WYD1 (good view)
DR GenBank; AAD35383
DR Pfam; PF00923; Transaldolase;
DR Interpro; IPR001585; Transaldolase;
DR Interpro; IPR004731; Transaldolase_C;
DR PDB; 1VPX; Identical; 07-DEC-04; PROTEIN (TRANSALDOLASE (EC 2.2.1.2));
DR PDB; 3S0C; Highly similar; 24-AUG-11; PROBABLE TRANSALDOLASE;
DR PDB; 3S1U; Highly similar; 24-AUG-11; PROBABLE TRANSALDOLASE;
DR PDB; 3S1V; Highly similar; 24-AUG-11; PROBABLE TRANSALDOLASE;
DR PDB; 3S1X; Highly similar; 24-AUG-11; PROBABLE TRANSALDOLASE;
DR PDB; 3S1W; Highly similar; 24-AUG-11; PROBABLE TRANSALDOLASE;
DR PDB; 3R8R; Highly similar; 08-FEB-12; TRANSALDOLASE;
DR PDB; 1WX0; Highly similar; 01-FEB-05; TRANSALDOLASE;
DR KEGG; 2.2.1.2; Enzyme page
DR FFAS; 282171; Fold and function assignment.
DR TVPC; TM0295; Homologs in PDB, JCSG and SG center.
DR OVP; TM0295; Ortholog view popup.
DR TPM; TM0295; Target PDB monitor.
DR FSS; TM0295; Target function coverage.
PROPERTY Residues: 218 aa
Molecule Weight: 24212 Dalton
Isoelectric Point: 5.14
Extinction Coefficient: 19940
Gravy Index: .05
Number of Met residues: 11
Percentage of Met residues: 5.05 %
Number of Cys residues: 1
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 218 aa
>TM0295  TM0295 transaldolase-related protein
MKIFLDTANLEEIKKGVEWGIVDGVTTNPTLISKEGAEFKQRVKEICDLVKGPVSAEVVS
LDYEGMVREARELAQISEYVVIKIPMTPDGIKAVKTLSAEGIKTNVTLVFSPAQAILAAK
AGATYVSPFVGRMDDLSNDGMRMLGEIVEIYNNYGFETEIIAASIRHPMHVVEAALMGVD
IVTMPFAVLEKLFKHPMTDLGIERFMEDWKKYLENLKK

CDS  cDNA 654 bp
   1 atgaagatct ttctggacac agcaaactta gaagagatca aaaaaggtgt tgaatggggt    60
  61 atcgtggatg gagtaacgac gaatccaaca ctgatttcaa aggaaggagc agagttcaaa   120
 121 cagagagtga aagagatctg cgatctggtg aaaggtcccg tttctgcgga ggttgtgtct   180
 181 ctcgactacg aaggcatggt gagagaggcg agagaactcg ctcagatcag cgaatacgtg   240
 241 gtgatcaaga taccaatgac acccgatggc atcaaagcgg tgaagactct ctctgcagag   300
 301 ggtataaaga caaacgtgac actcgtgttc agcccagccc aggccattct ggccgcgaaa   360
 361 gcgggagcaa cctacgtgag ccccttcgtt ggaaggatgg acgatctttc aaacgacgga   420
 421 atgagaatgc ttggagaaat cgtcgagatc tacaacaact acggtttcga aaccgagatc   480
 481 atcgccgcaa gcatcagaca tccaatgcac gtggtggaag cagcacttat gggtgtggat   540
 541 atcgtgacga tgccatttgc cgtgctggag aaactcttca aacacccgat gacggatctt   600
 601 ggaatagaaa ggttcatgga agactggaaa aagtatttgg agaacctgaa gaaa   654
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
313386 314042 -3 Glimmer3 score 15.89 good
Genemark probabilities .9   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu