LOADING...
   TM0293;TM0293
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0293    TM0293            JCSG 282169 PDB Deposition 03-FEB-12              PDB id: 1o20

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0293
DESCRIPTIONGamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5- semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA dehydrogenase).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CATALYZES THE NADPH DEPENDENT REDUCTION OF L-GAMMA-
GLUTAMYL 5-PHOSPHATE INTO L-GLUTAMATE 5-SEMIALDEHYDE AND
PHOSPHATE. THE PRODUCT SPONTANEOUSLY UNDERGOES CYCLIZATION TO FORM
1-PYRROLINE-5-CARBOXYLATE.
-!- CATALYTIC ACTIVITY: L-GLUTAMATE 5-SEMIALDEHYDE + PHOSPHATE +
NADP(+) = L-GAMMA-GLUTAMYL 5-PHOSPHATE + NADPH.
-!- PATHWAY: PROLINE BIOSYNTHESIS; SECOND STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE GAMMA-GLUTAMYL PHOSPHATE REDUCTASE
FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PROA_THEMA
DR SPTR; Q9WYC9 (flat text); Q9WYC9 (good view)
DR GenBank; AAD35381
DR Interpro; IPR002086; Aldehyde_dehydr;
DR Interpro; IPR000965; Gglut_pp_reduct;
DR PDB; 1O20; Identical; 01-APR-03; GAMMA-GLUTAMYL PHOSPHATE REDUCTASE;
DR PDB; 4GHK; Highly similar; 26-DEC-12; GAMMA-GLUTAMYL PHOSPHATE REDUCTASE;
DR PDB; 1VLU; Highly similar; 24-AUG-04; GAMMA-GLUTAMYL PHOSPHATE REDUCTASE;
DR PDB; 2H5G; Highly similar; 23-JUN-06; DELTA 1-PYRROLINE-5-CARBOXYLATE SYNTHETASE;
DR KEGG; 1.2.1.41; Enzyme page
DR FFAS; 282169; Fold and function assignment.
DR TVPC; TM0293; Homologs in PDB, JCSG and SG center.
DR OVP; TM0293; Ortholog view popup.
DR TPM; TM0293; Target PDB monitor.
DR FSS; TM0293; Target function coverage.
PROPERTY Residues: 415 aa
Molecule Weight: 46401.77 Dalton
Isoelectric Point: 5.98
Extinction Coefficient: 29910
Gravy Index: -.25
Number of Met residues: 3
Percentage of Met residues: 0.72 %
Number of Cys residues: 4
Percentage of Cys residues: 0.96 %
SEQUENCE  amino acids 415 aa
>TM0293  TM0293 gamma-glutamyl phosphate reductase (proA)
MDELLEKAKKVREAWDVLRNATTREKNKAIKKIAEKLDERRKEILEANRIDVEKARERGV
KESLVDRLALNDKRIDEMIKACETVIGLKDPVGEVIDSWVREDGLRIARVRVPIGPIGII
YESRPNVTVETTILALKSGNTILLRGGSDALNSNKAIVSAIREALKETEIPESSVEFIEN
TDRSLVLEMIRLREYLSLVIPRGGYGLISFVRDNATVPVLETGVGNCHIFVDESADLKKA
VPVIINAKTQRPGTCNAAEKLLVHEKIAKEFLPVIVEELRKHGVEVRGCEKTREIVPDVV
PATEDDWPTEYLDLIIAIKVVKNVDEAIEHIKKYSTGHSESILTENYSNAKKFVSEIDAA
AVYVNASTRFTDGGQFGFGAEIGISTQRFHARGPVGLRELTTYKFVVLGEYHVRE

CDS  cDNA 1245 bp
   1 gtggatgaac tcctcgagaa ggcgaagaag gtacgagagg cttgggatgt tctgagaaac    60
  61 gctacgacga gggaaaagaa caaagcgata aagaagatag ccgagaaact cgatgagagg   120
 121 agaaaagaaa tcctcgaagc gaacagaatc gacgtggaaa aggcccgcga gcggggtgtg   180
 181 aaggagtctc tcgttgacag actcgctctg aacgataaaa gaatcgatga gatgataaaa   240
 241 gcgtgtgaga cggtgattgg actgaaagat cccgtgggag aagtgatcga ttcttgggtg   300
 301 agagaagacg gactcagaat agcgagagtg agggttccca tcggtccgat agggatcatt   360
 361 tacgaatcca ggccgaacgt caccgtggag accacgatct tggccttgaa gagcggtaac   420
 421 accatactgc tcaggggcgg atccgacgct ttgaactcga acaaggcgat agtctcagcc   480
 481 ataagggagg cgctcaaaga aaccgagatt ccggaaagct ccgttgagtt catcgagaac   540
 541 accgacagat ccctcgttct tgagatgata cggctcaggg aatatctctc ccttgtcatt   600
 601 ccacgtggtg gatacggcct catcagcttt gtgcgtgaca acgcgaccgt tccggtactg   660
 661 gaaacaggtg ttggaaactg tcacatcttc gtcgatgaga gcgccgatct gaagaaggct   720
 721 gttccggtca taataaacgc gaagacacaa aggcctggta cctgtaacgc tgcagagaaa   780
 781 ctgctcgttc atgagaagat agcgaaggag tttcttcctg tgatcgtgga ggagctgaga   840
 841 aaacacggcg tcgaagtgag aggctgtgaa aagaccagag aaatcgtgcc ggacgtggta   900
 901 ccggctactg aagatgactg gcccaccgag tatctggacc tcatcatcgc catcaaagtg   960
 961 gtcaagaatg tggacgaggc gattgagcac ataaagaaat attccacagg acattccgaa  1020
1021 tcgattctga ctgaaaacta ttcgaacgct aaaaagttcg tttcagaaat cgatgccgca  1080
1081 gccgtttacg tgaacgcttc gaccagattc acagacggcg ggcagttcgg tttcggtgcc  1140
1141 gagatcggaa tcagcaccca gagattccac gcaagaggtc ccgtggggct cagagagctc  1200
1201 accacgtaca aattcgtcgt tcttggagag tatcatgtga gggaa  1245
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
311055 312302 3 Glimmer3 score - -
Genemark probabilities .96   .88 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu