LOADING...
   TM0262;TM0262
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0262    TM0262            JCSG 282139 PDB Deposition 04-NOV-09              PDB id: 1vpk

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0262
DESCRIPTIONDNA polymerase III, beta subunit.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYA0_THEMA
DR SPTR; Q9WYA0 (flat text); Q9WYA0 (good view)
DR GenBank; AAD35350
DR Pfam; PF02768; DNA_pol3_beta_3;
DR Pfam; PF00712; DNA_pol3_beta;
DR Pfam; PF02767; DNA_pol3_beta_2;
DR Interpro; IPR001001; DNA_polIII_beta;
DR PDB; 1VPK; Identical; 23-NOV-04; DNA POLYMERASE III, BETA SUBUNIT;
DR FFAS; 282139; Fold and function assignment.
DR TVPC; TM0262; Homologs in PDB, JCSG and SG center.
DR OVP; TM0262; Ortholog view popup.
DR TPM; TM0262; Target PDB monitor.
DR FSS; TM0262; Target function coverage.
PROPERTY Residues: 366 aa
Molecule Weight: 40945.89 Dalton
Isoelectric Point: 4.66
Extinction Coefficient: 14440
Gravy Index: -.04
Number of Met residues: 11
Percentage of Met residues: 3.01 %
Number of Cys residues: 2
Percentage of Cys residues: 0.55 %
SEQUENCE  amino acids 366 aa
>TM0262  TM0262 DNA polymerase III, beta subunit (dnaN)
MKVTVTTLELKDKITIASKALAKKSVKPILAGFLFEVKDGNFYICATDLETGVKATVNAA
EISGEARFVVPGDVIQKMVKVLPDEITELSLEGDALVISSGSTVFRITTMPADEFPEITP
AESGITFEVDTSLLEEMVEKVIFAAAKDEFMRNLNGVFWELHKNLLRLVASDGFRLALAE
EQIENEEEASFLLSLKSMKEVQNVLDNTTEPTITVRYDGRRVSLSTNDVETVMRVVDAEF
PDYKRVIPETFKTKVVVSRKELRESLKRVMVIASKGSESVKFEIEENVMRLVSKSPDYGE
VVDEVEVQKEGEDLVIAFNPKFIEDVLKHIETEEIEMNFVDSTSPCQINPLDISGYLYIV
MPIRLA

CDS  cDNA 1098 bp
   1 atgaaagtaa ccgtcacgac tcttgaattg aaagacaaaa taaccatcgc ctcaaaagcg    60
  61 ctcgcaaaga aatccgtgaa acccattctt gctggatttc ttttcgaagt gaaagatgga   120
 121 aatttctaca tctgcgcgac cgatctcgag accggagtca aagcaaccgt gaatgccgct   180
 181 gaaatctccg gtgaggcacg ttttgtggta ccaggagatg tcattcagaa gatggtcaag   240
 241 gttctcccag atgagataac ggaactttct ttagaggggg atgctcttgt tataagttct   300
 301 ggaagcaccg ttttcaggat caccaccatg cccgcggacg aatttccaga gataacgcct   360
 361 gccgagtctg gaataacctt cgaagttgac acttcgctcc tcgaggaaat ggttgaaaag   420
 421 gtcatcttcg ccgctgccaa agacgagttc atgcgaaatc tgaatggagt tttctgggaa   480
 481 ctccacaaga atcttctcag gctggttgca agtgatggtt tcagacttgc acttgctgaa   540
 541 gagcagatag aaaacgagga agaggcgagt ttcttgctct ctttgaagag catgaaagaa   600
 601 gttcaaaacg tgctggacaa cacaacggag ccgactataa cggtgaggta cgatggaaga   660
 661 agggtttctc tgtcgacaaa tgatgtagaa acggtgatga gagtggtcga cgctgaattt   720
 721 cccgattaca aaagggtgat ccccgaaact ttcaaaacga aagtggtggt ttccagaaaa   780
 781 gaactcaggg aatctttgaa gagggtgatg gtgattgcca gcaagggaag cgagtccgtg   840
 841 aagttcgaaa tagaagaaaa cgttatgaga cttgtgagca agagcccgga ttatggagaa   900
 901 gtggtcgatg aagttgaagt tcaaaaagaa ggggaagatc tcgtgatcgc tttcaacccg   960
 961 aagttcatcg aggacgtttt gaagcacatt gagactgaag aaatcgaaat gaacttcgtt  1020
1021 gattctacca gtccatgtca gataaatcca ctcgatattt ctggatacct ttacatagtg  1080
1081 atgcccatca gactggca  1098
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
271558 272658 1 Glimmer3 score 14.34 good
Genemark probabilities .91   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu