LOADING...
   TM0246;TM0246
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0246    TM0246            JCSG 358404 PDB Deposition 08-JUN-04              PDB id: 3dcz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0246
DESCRIPTIONPutative RnfG subunit of electron transport complex.
ORGANISMThermotoga maritima
COMMENTJaume Canaves wrote:
Contains Interpro IPR010209 domain. This family contains several NADH oxidoreductase complexes. One of those is NQR, a Na(+)-translocating NADH-quinone reductase. TM0245, TM0247 and TM0248 are annotated as members of the NQR complex, so this protein is most probably another subunit in that complex.
DR UNIPROT; Q9WY88_THEMA
DR SPTR; Q9WY88 (flat text); Q9WY88 (good view)
DR GenBank; AAD35337
DR PDB; 3DCZ; Identical; 24-JUN-08; PUTATIVE RNFG SUBUNIT OF ELECTRON TRANSPORT COMPL CHAIN: A;
DR FFAS; 282125; Fold and function assignment.
DR TVPC; TM0246; Homologs in PDB, JCSG and SG center.
DR OVP; TM0246; Ortholog view popup.
DR TPM; TM0246; Target PDB monitor.
DR FSS; TM0246; Target function coverage.
PROPERTY Residues: 224 aa
Molecule Weight: 24396.21 Dalton
Isoelectric Point: 6.44
Extinction Coefficient: 13410
Gravy Index: .05
Number of Met residues: 5
Percentage of Met residues: 2.23 %
Number of Cys residues: 1
Percentage of Cys residues: 0.45 %
SEQUENCE  amino acids 224 aa
>TM0246  TM0246 hypothetical protein
MKDILKTGLILMVFTAISGLFLGLVYVGVKGKIQEADNAAKLSAIKFVLKDPLTGDYLVD
EKEIEEIVKKTGIETVVLKEYKEGVVLGPLYEFVTKDGRNAYVLSGYAPGFGGNVTVVAC
FIKTEDGFMLNSVRVIDYSQETPGLGAKIGEESIQRRFFPVPPEGLKNGLRVDKDAGLPK
GSPEELKKQGIVKVSDVMTGATITPRAVVTALNLMYRYLEEVSK

CDS  cDNA 672 bp
   1 atgaaggata tcctgaagac tggattgatt ctgatggttt tcacggctat ttctggactc    60
  61 tttcttggac tcgtgtatgt gggagtcaaa ggaaagatcc aggaagcgga taacgcagct   120
 121 aagttgagcg ccatcaaatt cgttctgaaa gatcccctca cgggagatta tctggtggat   180
 181 gaaaaagaaa tcgaggaaat cgtcaaaaaa acaggcatag aaacggttgt tctgaaagag   240
 241 tacaaagaag gggtagtcct tggtcccttg tatgaattcg tgacgaagga tggcagaaac   300
 301 gcatacgttc tgtcgggata cgcacccggt tttggaggaa acgtgaccgt tgtagcctgt   360
 361 tttataaaaa cggaagatgg attcatgctc aattccgtga gagtaataga ttattctcag   420
 421 gagacgcctg gactcggcgc aaagatagga gaagaaagta tacagaggcg tttctttcca   480
 481 gttccacccg aaggactgaa gaacggcctg agggtcgaca aagatgcggg acttccgaag   540
 541 ggttctcctg aggagttgaa aaagcagggt attgtgaagg taagcgatgt aatgacggga   600
 601 gcaacgatca caccaagggc cgtggtgacc gctctgaatc tcatgtacag gtacctcgag   660
 661 gaggtgtcga aa   672
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
260823 261497 3 Glimmer3 score 11.46 poor
Genemark probabilities .86   .54 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu